StarFunc result for job id Q8TDR0

User Input

>input (691 residues)
MNAAVVRRTQEALGKVIRRPPLTEKLLSKPPFRYLHDIITEVIRMTGFMKGLYTDAEMKS
DNVKDKDAKISFLQKAIDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLNKLS
SDDAVRRVLAGEKGEVKGRASLTSRSQELDNKNVREEESRVHKNTEDRGDAEIKERSTSR
DRKQKEELKEDRKPREKDKDKEKAKENGGNRHREGERERAKARARPDNERQKDRGNRERD
RDSERKKETERKSEGGKEKERLRDRDRERDRDKGKDRDRRRVKNGEHSWDLDREKNREHD
KPEKKSASSGEMSKKLSDGTFKDSKAETETEISTRASKSLTTKTSKRRSKNSVEGRKEDN
ISAKSLDSIVSGINNEPNQETTTSEIGTKEANINSTSISDDNSASLRCENIQPNPTEKQK
GDSTSDAEGDAGPAGQDKSEVPETPEIPNELSSNIRRIPRPGSARPAPPRVKRQDSMEAL
QMDRSGSGKTVSNVITESHNSDNEEDDQFVVEAAPQLSEMSEIEMVTAVELEEEEKHGGL
VKKILETKKDYEKLQQSPKPGEKERSLFESAWKKEKDIVSKEIEKLRTSIQTLCKSALPL
GKIMDYIQEDVDAMQNELQMWHSENRQHAEALQQEQRITDCAVEPLKAELAELEQLIKDQ
QDKICAVKANILKNEEKIQKMVYSINLTSRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDR0	1.000	1.000	1.004E-81	691	1.000	1.000	Q8TDR0.pdb.gz	MIPT3_HUMAN TRAF3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TRAF3IP1 PE=1 SV=1
2	AFDB:Q149C2	0.337	0.366	1.027E-51	625	0.692	0.765	Q149C2.pdb.gz	MIPT3_MOUSE TRAF3-interacting protein 1 OS=Mus musculus OX=10090 GN=Traf3ip1 PE=1 SV=2
3	AFDB:Q6PGZ3	0.256	0.276	1.067E-36	629	0.483	0.531	Q6PGZ3.pdb.gz	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
4	AFDB:A8JBY2	0.234	0.298	1.822E-14	510	0.229	0.310	A8JBY2.pdb.gz	A8JBY2_CHLRE Uncharacterized protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_11g467739v5 PE=1 SV=1
5	AFDB:Q387G7	0.115	0.098	3.034E-3	835	0.133	0.110	Q387G7.pdb.gz	Q387G7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0310 PE=4 SV=1
6	AFDB:Q3UHC7	0.117	0.071	6.457E-3	1189	0.137	0.080	Q3UHC7.pdb.gz	DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1
7	AFDB:A8T6P4	0.121	0.103	3.438E-2	838	0.151	0.124	A8T6P4.pdb.gz	MYRIP_DANRE Rab effector MyRIP OS=Danio rerio OX=7955 GN=myrip PE=1 SV=1
8	AFDB:Q9W6J4	0.070	0.062	5.293E-2	893	0.090	0.069	Q9W6J4.pdb.gz
9	AFDB:Q67YI9	0.059	0.050	6.931E-2	895	0.130	0.101	Q67YI9.pdb.gz	EPN2_ARATH Clathrin interactor EPSIN 2 OS=Arabidopsis thaliana OX=3702 GN=EPSIN2 PE=1 SV=1
10	AFDB:Q8IVL0	0.120	0.041	1.126E-1	2385	0.107	0.031	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
11	PDB:7r97A	0.079	0.160	1.249	226	0.030	0.093	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
12	PDB:6ox1B	0.044	0.059	1.549	484	0.025	0.035	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
13	PDB:7wv9R	0.067	0.118	1.923	290	0.033	0.079	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
14	PDB:6ylgb	0.057	0.060	2.960	613	0.026	0.029	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
15	PDB:2rsvA	0.061	0.092	3.124	403	0.045	0.077	2rsvA.pdb.gz
16	PDB:2iw3B	0.051	0.038	3.297	980	0.012	0.008	2iw3B.pdb.gz	Structure of Eef3 and the Mechanism of Transfer RNA Release from the E-Site.
17	PDB:6wwzR	0.051	0.088	3.297	310	0.027	0.061	6wwzR.pdb.gz
18	PDB:6tljS	0.055	0.102	3.673	293	0.048	0.113	6tljS.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.
19	PDB:3vv9B	0.060	0.102	3.876	268	0.023	0.060	3vv9B.pdb.gz	Structure of the trypanosome cyanide-insensitive alternative oxidase
20	PDB:4d1eA	0.115	0.096	3.876	859	0.020	0.016	4d1eA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TDR0	0.0	1396	691	1.000	1.000	MIPT3_HUMAN TRAF3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TRAF3IP1 PE=1 SV=1
2	Q6PGZ3	2.96e-179	526	629	0.489	0.537	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
3	Q149C2	2.49e-155	465	625	0.331	0.366	MIPT3_MOUSE TRAF3-interacting protein 1 OS=Mus musculus OX=10090 GN=Traf3ip1 PE=1 SV=2
4	Q9VFL0	7.08e-29	124	588	0.113	0.133	Q9VFL0_DROME IP21508p OS=Drosophila melanogaster OX=7227 GN=IFT54 PE=2 SV=1
5	A8JBY2	8.76e-29	123	510	0.084	0.114	A8JBY2_CHLRE Uncharacterized protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_11g467739v5 PE=1 SV=1
6	Q17595	1.97e-18	91.7	535	0.067	0.086	Q17595_CAEEL TRAF3-interacting protein 1 OS=Caenorhabditis elegans OX=6239 GN=dyf-11 PE=4 SV=1
7	Q38CJ3	1.39e-16	85.9	585	0.113	0.133	Q38CJ3_TRYB2 TRAF3-interacting protein 1 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7880 PE=4 SV=1
8	Q381W6	8.30e-11	66.2	339	0.043	0.088	Q381W6_TRYB2 TRAF3-interacting protein 1 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6310 PE=4 SV=1
9	F1QBY1	2.51e-07	57.0	2876	0.094	0.023	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
10	F1RAH8	1.06e-05	50.8	450	0.068	0.104	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1
11	Q9LFE0	2.09e-05	50.4	820	0.077	0.065	DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana OX=3702 GN=DOT2 PE=1 SV=1
12	Q4QRG7	6.99e-05	48.1	434	0.072	0.115	Q4QRG7_DANRE RNA-binding motif protein, X-linked 2 OS=Danio rerio OX=7955 GN=zgc:113884 PE=2 SV=1
13	A8JNI2	0.15	38.1	1655	0.045	0.019	A8JNI2_DROME Serine-arginine repetitive matrix 2/3/4, isoform F OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=2
14	F4HQR9	0.19	37.4	788	0.043	0.038	F4HQR9_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=PRP4KB PE=1 SV=1
15	Q8C761	0.35	36.6	999	0.039	0.027	DC2I1_MOUSE Cytoplasmic dynein 2 intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync2i1 PE=1 SV=1
16	O23212	0.58	35.8	573	0.056	0.068	U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF65A PE=1 SV=2
17	Q9VJ87	0.76	35.8	1330	0.062	0.032	CWC22_DROME Pre-mRNA-splicing factor CWC22 homolog OS=Drosophila melanogaster OX=7227 GN=ncm PE=1 SV=3
18	F8W3Z0	1.1	35.0	2280	0.069	0.021	F8W3Z0_DANRE Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b OS=Danio rerio OX=7955 GN=CACNA1Ab PE=2 SV=2
19	Q8C9B9	1.1	35.0	2256	0.026	0.008	DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus OX=10090 GN=Dido1 PE=1 SV=4
20	Q9W0B0	1.2	35.0	1107	0.045	0.028	Q9W0B0_DROME Serine-arginine repetitive matrix 2/3/4, isoform C OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10243 MIP-T3	4e-49	176.7	Microtubule-binding protein MIP-T3 CH-like domain
2	PF17749 MIP-T3_C	1.1e-60	215.6	Microtubule-binding protein MIP-T3 C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362424

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264538	0.997	Intraflagellar transport protein 57 homolog
2	9606.ENSP00000464443	0.995	Intraflagellar transport protein 20 homolog
3	9606.ENSP00000242591	0.994	Intraflagellar transport protein 81 homolog
4	9606.ENSP00000260570	0.993	Intraflagellar transport protein 172 homolog
5	9606.ENSP00000460850	0.989	Clusterin-associated protein 1
6	9606.ENSP00000323580	0.982	Intraflagellar transport protein 88 homolog
7	9606.ENSP00000362121	0.979	Intraflagellar transport protein 52 homolog
8	9606.ENSP00000419279	0.976	Intraflagellar transport protein 56
9	9606.ENSP00000454207	0.976	TNF receptor-associated factor 3
10	9606.ENSP00000312778	0.975	Intraflagellar transport protein 80 homolog
11	9606.ENSP00000264020	0.974	Intraflagellar transport proteins
12	9606.ENSP00000320359	0.970	Intraflagellar transport protein 22 homolog
13	9606.ENSP00000404122	0.967	Intraflagellar transport protein 74 homolog
14	9606.ENSP00000314444	0.966	WD repeat-containing protein 35
15	9606.ENSP00000386181	0.966	Tetratricopeptide repeat protein 30B
16	9606.ENSP00000406012	0.964	Intraflagellar transport protein 140 homolog
17	9606.ENSP00000355593	0.961	Disrupted in schizophrenia 1 protein
18	9606.ENSP00000445408	0.949	Rab GTPase-binding effector protein 1
19	9606.ENSP00000382717	0.938	WD repeat-containing protein 19
20	9606.ENSP00000347915	0.936	Tetratricopeptide repeat protein 30A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.982	regulation of cellular process
GO:0032502	0.962	developmental process
GO:0048856	0.954	anatomical structure development
GO:0032501	0.950	multicellular organismal process
GO:0033043	0.941	regulation of organelle organization
GO:0080134	0.931	regulation of response to stress
GO:0009987	0.919	cellular process
GO:0002009	0.914	morphogenesis of an epithelium
GO:0007275	0.912	multicellular organism development
GO:0019222	0.897	regulation of metabolic process
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:0032886	0.884	regulation of microtubule-based process
GO:0071840	0.874	cellular component organization or biogenesis
GO:0051493	0.859	regulation of cytoskeleton organization
GO:0048731	0.856	system development
GO:0016043	0.855	cellular component organization
GO:0044087	0.852	regulation of cellular component biogenesis
GO:0048523	0.813	negative regulation of cellular process
GO:0048513	0.796	animal organ development
GO:0070507	0.786	regulation of microtubule cytoskeleton organization
GO:0010468	0.750	regulation of gene expression
GO:0006996	0.664	organelle organization
GO:0051179	0.579	localization
GO:0043254	0.527	regulation of protein-containing complex assembly
GO:0060271	0.486	cilium assembly
GO:0031323	0.472	regulation of cellular metabolic process
GO:0080090	0.453	regulation of primary metabolic process
GO:0051171	0.453	regulation of nitrogen compound metabolic process
GO:0051641	0.422	cellular localization
GO:0051234	0.415	establishment of localization
GO:0006810	0.400	transport
GO:0001738	0.387	morphogenesis of a polarized epithelium
GO:0050687	0.385	negative regulation of defense response to virus
GO:0032480	0.385	negative regulation of type I interferon production
GO:0007017	0.376	microtubule-based process
GO:0007018	0.372	microtubule-based movement
GO:0099111	0.371	microtubule-based transport
GO:0051246	0.349	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030992	1.000	intraciliary transport particle B
GO:0005929	1.000	cilium
GO:0005622	0.995	intracellular anatomical structure
GO:0005737	0.992	cytoplasm
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0097542	0.989	ciliary tip
GO:0005815	0.951	microtubule organizing center
GO:0005829	0.928	cytosol
GO:0005813	0.884	centrosome
GO:0035869	0.876	ciliary transition zone
GO:0097546	0.873	ciliary base
GO:0036064	0.350	ciliary basal body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]