StarFunc result for job id Q8TDW7

User Input

>input (1400 residues)
MDIIMGHCVGTRPPACCLILLLFKLLATVSQGLPGTGPLGFHFTHSIYNATVYENSAART
YVNSQSRMGITLIDLSWDIKYRIVSGDEEGFFKAEEVIIADFCFLRIRTKGGNSAILNRE
IQDNYLLIVKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSVAQV
TATDADIGSNGEFYYYFKNKVDLFSVHPTSGVISLSGRLNYDEKNRYDLEILAVDRGMKL
YGNNGVSSTAKLYVHIERINEHAPTIHVVTHVPFSLEKEPTYAVVTVDDLDDGANGEIES
VSIVAGDPLDQFFLAKEGKWLNEYKIKERKQIDWESFPYGYNLTLQAKDKGSPQKCSALK
AVYIGNPTRDTVPIRFEKEVYDVSISEFSPPGVVVAIVKLSPEPIDVEYKLSPGEDAVYF
KINPRSGLIVTARPLNTVKKEVYKLEVTNKEGDLKAQVTISIEDANDHTPEFQQPLYDAY
VNESVPVGTSVLTVSASDKDKGENGYITYSIASLNLLPFVINQFTGVISTTEELDFESSP
EIYRFIVRASDWGSPYRHESEVNVTIRIGNVNDNSPLFEKVACQGVISYDFPVGGHITAV
SAIDIDELELVKYKIISGNELGFFYLNPDSGVLQLKKSLTNSGIKNGNFALRITATDGEN
LADPMSINISVLHGKVSSKSFSCRETRVAQKLAEKLLIKAKANGKLNLEDGFLDFYSINR
QGPYFDKSFPSDVAVKEDLPVGANILKIKAYDADSGFNGKVLFTISDGNTDSCFNIDMET
GQLKVLMPMDREHTDLYLLNITIYDLGNPQKSSWRLLTINVEDANDNSPVFIQDSYSVNI
LESSGIGTEIIQVEARDKDLGSNGEVTYSVLTDTQQFAINSSTGIVYVADQLDRESKANY
SLKIEARDKAESGQQLFSVVTLKVFLDDVNDCSPAFIPSSYSVKVLEDLPVGTVIAWLET
HDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLSKELDYEKQQFYNLTVRAKDKGRPVS
LSSVSFVEVEVVDVNENLHTPYFPDFAVVGSVKENSRIGTSVLQVTARDEDSGRDGEIQY
SIRDGSGLGRFSIDDESGVITAADILDRETMGSYWLTVYATDRGVVPLYSTIEVYIEVED
VNDNAPLTSEPIYYPVVMENSPKDVSVIQIQAEDPDSSSNEKLTYRITSGNPQNFFAINI
KTGLITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQVLDENDNKPQFPEKVYQ
IKLPERDRKKRGEPIYRAFAFDRDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQFT
AGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPPPSPIPLTFDEPFYNFTVMESDRVTEI
VGVVSVQPANTPLWFDIVGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08C65	0.188	0.298	5.312E-87	847	0.319	0.528	Q08C65.pdb.gz
2	AFDB:Q9VVG0	0.214	0.171	5.320E-79	1820	0.249	0.191	Q9VVG0.pdb.gz	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
3	AFDB:A0A0R4IZF0	0.137	0.103	6.390E-79	1907	0.229	0.168	A0A0R4IZF0.pdb.gz
4	AFDB:Q5ICW6	0.150	0.126	1.146E-77	1796	0.228	0.178	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
5	AFDB:Q9VFH5	0.148	0.112	1.315E-77	1981	0.247	0.175	Q9VFH5.pdb.gz	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
6	AFDB:Q99PJ1	0.141	0.105	3.605E-77	1943	0.225	0.162	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
7	AFDB:Q0ZM14	0.143	0.112	3.607E-73	1899	0.237	0.175	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
8	AFDB:Q9VAF5	0.172	0.146	4.486E-72	1706	0.210	0.172	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
9	AFDB:Q96QU1	0.143	0.107	4.386E-70	1955	0.229	0.164	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
10	AFDB:G5EDK5	0.142	0.086	7.692E-67	2596	0.198	0.107	G5EDK5.pdb.gz	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
11	PDB:7sqcO0	0.097	0.113	2.355E-18	1140	0.070	0.086	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6velC	0.129	0.759	4.228E-13	209	0.046	0.306	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:4aq1A	0.068	0.113	4.582E-12	721	0.077	0.150	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:5oj2B	0.104	0.178	1.579E-11	692	0.061	0.124	5oj2B.pdb.gz
15	PDB:1e07A	0.089	0.169	4.530E-11	642	0.059	0.128	1e07A.pdb.gz
16	PDB:5a42A	0.065	0.070	1.300E-10	1597	0.102	0.090	5a42A.pdb.gz
17	PDB:4ziqA	0.070	0.068	8.127E-10	1450	0.086	0.083	4ziqA.pdb.gz
18	PDB:7q5zA	0.086	0.089	5.570E-9	1344	0.078	0.081	7q5zA.pdb.gz
19	PDB:7nycA	0.063	0.059	7.946E-8	1542	0.069	0.062	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7vonA	0.106	0.106	1.654E-7	1399	0.088	0.088	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WRT4	0.0	1617	4602	0.583	0.177	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
2	A0A1L1SQU7	0.0	1615	4645	0.582	0.175	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
3	A0A2R8QAL3	0.0	1866	4601	0.651	0.198	A0A2R8QAL3_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
4	A2BGT8	0.0	1624	4611	0.575	0.175	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1
5	F1QA09	0.0	1869	4546	0.652	0.201	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
6	F2Z4A3	0.0	1617	4590	0.583	0.178	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
7	O88277	0.0	1249	4351	0.449	0.145	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
8	Q14517	0.0	1614	4588	0.578	0.176	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
9	Q8BNA6	0.0	2649	4555	0.936	0.288	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
10	Q9NYQ8	0.0	1258	4349	0.455	0.146	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
11	Q9QXA3	0.0	1615	4587	0.583	0.178	Q9QXA3_MOUSE Fat 1 cadherin (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
12	Q9VW71	0.0	929	4699	0.402	0.120	FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster OX=7227 GN=kug PE=2 SV=3
13	Q9WU10	0.0	1605	4589	0.577	0.176	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
14	X1WCY4	0.0	1869	4578	0.652	0.199	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
15	Q6V0I7	8.74e-134	460	4981	0.290	0.082	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
16	Q2PZL6	4.75e-132	455	4981	0.287	0.081	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
17	Q6QQE1	1.45e-121	423	3366	0.277	0.115	Q6QQE1_DANRE Cadherin 23 OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
18	Q99PF4	1.89e-119	416	3354	0.287	0.120	CAD23_MOUSE Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1 SV=2
19	P58365	2.23e-117	410	3317	0.285	0.120	CAD23_RAT Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1
20	Q24292	2.10e-115	404	3503	0.269	0.108	DS_DROME Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	4.1e-179	593.0	Cadherin domain
2	PF08266 Cadherin_2	7.5e-10	49.8	Cadherin-like
3	PF16184 Cadherin_3	2.6e-07	41.9	Cadherin-like
4	PF17803 Cadherin_4	1.4e+02	14.5	Bacterial cadherin-like domain
5	PF01789 PsbP	44	15.6	PsbP
6	PF18957 RibLong	3	20.0	Long Rib domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008964631.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003830572.1	0.798	Four-jointed box protein 1
2	9597.XP_008973906.1	0.795	Arginine-glutamic acid dipeptide repeats
3	9597.XP_003829253.1	0.736	Catenin alpha 1
4	9597.XP_008967894.1	0.736	Catenin alpha-2 isoform X1
5	9597.XP_003813825.1	0.650	Belongs to the G-protein coupled receptor 1 family.
6	9597.XP_008967710.1	0.618	Protocadherin Fat 4 isoform X1
7	9597.XP_003823542.1	0.615	Belongs to the G-protein coupled receptor 1 family.
8	9597.XP_008949747.1	0.603	Catenin beta 1
9	9597.XP_008967221.1	0.586	Cadherin related 23
10	9597.XP_003822631.2	0.580	Protocadherin-23
11	9597.XP_008974475.1	0.575	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 22% coverage of the annotated genomic feature by RNAseq alignments
12	9597.XP_008970730.1	0.573	Dachsous cadherin-related 1
13	9597.XP_003806238.1	0.571	Limb and CNS expressed 1 like
14	9597.XP_003817977.1	0.571	Limb and CNS expressed 1
15	9597.XP_008966032.1	0.569	Enabled homolog (Drosophila)
16	9597.XP_008973638.1	0.565	Cms1 ribosomal small subunit homolog (yeast)
17	9597.XP_003831637.1	0.560	Belongs to the tumor necrosis factor family.
18	9597.XP_008959349.1	0.542	Casein kinase I isoform delta isoform X1
19	9597.XP_008973328.1	0.542	Belongs to the protein kinase superfamily.
20	9597.XP_003820503.1	0.541	Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity).

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.941	anatomical structure development
GO:0007275	0.841	multicellular organism development
GO:0048731	0.734	system development
GO:0009987	0.695	cellular process
GO:0009653	0.658	anatomical structure morphogenesis
GO:0048513	0.548	animal organ development
GO:0009887	0.450	animal organ morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.966	membrane
GO:0043226	0.915	organelle
GO:0005886	0.894	plasma membrane
GO:0042995	0.766	cell projection
GO:0120025	0.711	plasma membrane bounded cell projection
GO:0030054	0.662	cell junction
GO:0043227	0.647	membrane-bounded organelle
GO:0005622	0.512	intracellular anatomical structure
GO:0043229	0.455	intracellular organelle
GO:0043231	0.453	intracellular membrane-bounded organelle
GO:0098590	0.368	plasma membrane region
GO:0070013	0.364	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]