StarFunc result for job id Q8TDX5

User Input

>input (336 residues)
MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRI
REMDQKGVTVQALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQ
APELAVKEMERCVKELGFPGVQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQM
DGRMAKYWLPWLVGMPAETTIAICSMIMGGVFEKFPKLKVCFAHGGGAFPFTVGRISHGF
SMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE
PGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDX5	1.000	1.000	1.617E-67	336	1.000	1.000	Q8TDX5.pdb.gz	ACMSD_HUMAN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Homo sapiens OX=9606 GN=ACMSD PE=1 SV=1
2	PDB:4ofcA	0.992	0.995	1.750E-62	335	0.997	1.000	4ofcA.pdb.gz	Human alpha-amino-beta-carboxymuconate-epsilon-semialdehyde decarboxylase (ACMSD): A structural and mechanistic unveiling.
3	AFDB:Q8R5M5	0.998	0.998	3.219E-61	336	0.860	0.860	Q8R5M5.pdb.gz	ACMSD_RAT 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Rattus norvegicus OX=10116 GN=Acmsd PE=1 SV=1
4	PDB:7pwyC	0.887	0.990	2.889E-50	301	0.887	0.990	7pwyC.pdb.gz	Structural Basis of Human Dimeric alpha-Amino-beta-Carboxymuconate-epsilon-Semialdehyde Decarboxylase Inhibition With TES-1025.
5	AFDB:A0A075TXZ1	0.759	0.785	1.497E-18	324	0.223	0.231	A0A075TXZ1.pdb.gz	PATG_PENEN 6-methylsalicylic acid decarboxylase OS=Penicillium expansum OX=27334 GN=patG PE=1 SV=1
6	AFDB:A1CFL4	0.772	0.796	4.990E-18	325	0.196	0.203	A1CFL4.pdb.gz	PATG_ASPCL 6-methylsalicylic acid decarboxylase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patG PE=1 SV=1
7	AFDB:Q5AUW9	0.709	0.719	2.723E-17	331	0.185	0.187	Q5AUW9.pdb.gz	ORSB_EMENI Decarboxylase orsB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=orsB PE=2 SV=1
8	AFDB:Q682E0	0.571	0.556	1.794E-8	346	0.152	0.147	Q682E0.pdb.gz	Q682E0_ARATH Catalytic/ hydrolase OS=Arabidopsis thaliana OX=3702 GN=At2g35440 PE=1 SV=1
9	AFDB:C8VUF6	0.476	0.456	3.830E-6	355	0.158	0.149	C8VUF6.pdb.gz	C8VUF6_EMENI dihydroorotase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10131 PE=3 SV=1
10	PDB:6l0aC	0.457	0.426	3.772E-5	365	0.134	0.123	6l0aC.pdb.gz	Structural Analysis of Saccharomyces cerevisiae Dihydroorotase Reveals Molecular Insights into the Tetramerization Mechanism
11	PDB:2z26A	0.378	0.371	1.258E-4	344	0.131	0.128	2z26A.pdb.gz	Kinetic and Structural Analysis of Mutant Escherichia coli Dihydroorotases: A Flexible Loop Stabilizes the Transition State
12	AFDB:P05020	0.380	0.369	1.866E-4	348	0.131	0.126	P05020.pdb.gz	PYRC_ECOLI Dihydroorotase OS=Escherichia coli (strain K12) OX=83333 GN=pyrC PE=1 SV=2
13	AFDB:Q93PS7	0.480	0.521	5.889E-4	305	0.131	0.144	Q93PS7.pdb.gz	LIGI_COMTE 2-pyrone-4,6-dicarbaxylate hydrolase OS=Comamonas testosteroni OX=285 GN=pmdD PE=1 SV=1
14	AFDB:O04904	0.381	0.345	6.940E-4	377	0.128	0.114	O04904.pdb.gz	PYRC_ARATH Dihydroorotase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PYR4 PE=1 SV=1
15	PDB:2i5gA	0.435	0.448	7.655E-4	325	0.122	0.126	2i5gA.pdb.gz
16	PDB:3e74B	0.433	0.350	1.063E-3	433	0.134	0.104	3e74B.pdb.gz	Crystal structure of metal-dependent allantoinase from Escherichia coli
17	PDB:1yixA	0.483	0.588	3.355E-3	265	0.116	0.147	1yixA.pdb.gz	Crystal structure of ycfH, tatD homolog from Escherichia coli
18	PDB:2ftwA	0.557	0.403	7.220E-3	484	0.137	0.095	2ftwA.pdb.gz	The Crystal Structures of Dihydropyrimidinases Reaffirm the Close Relationship between Cyclic Amidohydrolases and Explain Their Substrate Specificity.
19	PDB:1bf6A	0.400	0.450	8.508E-3	291	0.104	0.120	1bf6A.pdb.gz	Biochemical characterization and crystallographic structure of an Escherichia coli protein from the phosphotriesterase gene family.
20	PDB:1zzmA	0.449	0.558	1.003E-2	259	0.098	0.127	1zzmA.pdb.gz	Crystal structure of YJJV, TATD homolog from Escherichia coli K12, at 1.8 A resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R5M5	0.0	623	336	0.860	0.860	ACMSD_RAT 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Rattus norvegicus OX=10116 GN=Acmsd PE=1 SV=1
2	Q8TDX5	0.0	697	336	1.000	1.000	ACMSD_HUMAN 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase OS=Homo sapiens OX=9606 GN=ACMSD PE=1 SV=1
3	Q5AUW9	7.89e-16	79.3	331	0.205	0.208	ORSB_EMENI Decarboxylase orsB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=orsB PE=2 SV=1
4	Q8K370	2.1	32.7	1069	0.101	0.032	ACD10_MOUSE Acyl-CoA dehydrogenase family member 10 OS=Mus musculus OX=10090 GN=Acad10 PE=1 SV=1
5	Q9STR4	4.5	31.6	447	0.057	0.043	1A17_ARATH 1-aminocyclopropane-1-carboxylate synthase 7 OS=Arabidopsis thaliana OX=3702 GN=ACS7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04909 Amidohydro_2	6.9e-70	247.6	Amidohydrolase
2	PF11178 DUF2963	4.9e+02	11.8	Protein of unknown function (DUF2963)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000294973	0.989	3-hydroxyanthranilate 3,4-dioxygenase
2	9606.ENSP00000265605	0.920	Aldehyde dehydrogenase family 8 member A1
3	9606.ENSP00000264170	0.893	Kynureninase
4	9606.ENSP00000265594	0.871	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
5	9606.ENSP00000378782	0.820	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
6	9606.ENSP00000355517	0.811	Kynurenine 3-monooxygenase
7	9606.ENSP00000253079	0.804	Coiled-coil domain-containing protein 62
8	9606.ENSP00000444788	0.736	Tryptophan 2,3-dioxygenase
9	9606.ENSP00000454748	0.724	Leucine-rich repeat-containing protein 9
10	9606.ENSP00000303246	0.693	Acyl-coenzyme A thioesterase 12
11	9606.ENSP00000314499	0.693	Cyclin-G-associated kinase
12	9606.ENSP00000253083	0.691	Huntingtin-interacting protein 1-related protein
13	9606.ENSP00000264711	0.690	DnaJ homolog subfamily C member 27
14	9606.ENSP00000357307	0.689	Synaptotagmin-11
15	9606.ENSP00000237642	0.688	Starch-binding domain-containing protein 1
16	9606.ENSP00000258145	0.687	N-acetylglucosamine-6-sulfatase
17	9606.ENSP00000356382	0.686	Coagulation factor XIII B chain
18	9606.ENSP00000348278	0.683	STE20/SPS1-related proline-alanine-rich protein kinase
19	9606.ENSP00000377520	0.681	Synaptotagmin-12
20	9606.ENSP00000373073	0.660	Urocanate hydratase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001760	1.000	aminocarboxymuconate-semialdehyde decarboxylase activity
GO:0005515	0.999	protein binding
GO:0046914	0.995	transition metal ion binding
GO:0008270	0.994	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:1901564	0.972	organonitrogen compound metabolic process
GO:0019752	0.958	carboxylic acid metabolic process
GO:0044248	0.956	cellular catabolic process
GO:0034641	0.954	cellular nitrogen compound metabolic process
GO:1901606	0.948	alpha-amino acid catabolic process
GO:0046700	0.944	heterocycle catabolic process
GO:0006568	0.944	tryptophan metabolic process
GO:0009063	0.936	amino acid catabolic process
GO:1901361	0.932	organic cyclic compound catabolic process
GO:0044270	0.919	cellular nitrogen compound catabolic process
GO:0019439	0.910	aromatic compound catabolic process
GO:0009074	0.898	aromatic amino acid family catabolic process
GO:0065007	0.896	biological regulation
GO:0050789	0.787	regulation of biological process
GO:0050794	0.769	regulation of cellular process
GO:0019222	0.685	regulation of metabolic process
GO:0048519	0.654	negative regulation of biological process
GO:0031323	0.619	regulation of cellular metabolic process
GO:0051171	0.551	regulation of nitrogen compound metabolic process
GO:0080090	0.547	regulation of primary metabolic process
GO:0048523	0.502	negative regulation of cellular process
GO:0044249	0.322	cellular biosynthetic process
GO:1901576	0.304	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.538	organelle
GO:0043227	0.530	membrane-bounded organelle
GO:0043231	0.505	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16557	1.000	2-amino-3-carboxymuconate 6-semialdehyde + H(+) = 2-aminomuconate 6-semialdehyde + CO2
EC:4.1.1.45	1.000	aminocarboxymuconate-semialdehyde decarboxylase.

[back to server]