StarFunc result for job id Q8TDX6

User Input

>input (532 residues)
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAV
LQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADL
LAFLHSQVDKAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDEL
VEAIESALETLNSPAENSPNHRPYTASDFIEGIYRTERDKGTLYELTFKGDHKHEFKRLI
LFRPFGPIMKVKNEKLNMANTLINVIVPLAKRVDKFRQFMQNFREMCIEQDGRVHLTVVY
FGKEEINEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGARFWKGSNVLLFFCDVD
IYFTSEFLNTCRLNTQPGKKVFYPVLFSQYNPGIIYGHHDAVPPLEQQLVIKKETGFWRD
FGFGMTCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKR
CMDELTPEQYKMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDX6	1.000	1.000	1.590E-103	532	1.000	1.000	Q8TDX6.pdb.gz	CGAT1_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=CSGALNACT1 PE=1 SV=2
2	AFDB:E7F6G2	0.810	0.744	3.694E-82	580	0.711	0.652	E7F6G2.pdb.gz	E7F6G2_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=csgalnact1a PE=3 SV=1
3	AFDB:Q8C1F4	0.828	0.813	1.037E-74	542	0.592	0.581	Q8C1F4.pdb.gz	CGAT2_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=Csgalnact2 PE=2 SV=1
4	AFDB:A8E7C8	0.857	0.845	7.824E-74	540	0.611	0.602	A8E7C8.pdb.gz
5	AFDB:A1Z863	0.735	0.724	1.586E-55	540	0.395	0.389	A1Z863.pdb.gz	A1Z863_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=Csgalnact PE=2 SV=1
6	AFDB:A0A0S2Z5K4	0.551	0.690	1.324E-40	416	0.382	0.488	A0A0S2Z5K4.pdb.gz	A0A0S2Z5K4_HUMAN Hexosyltransferase OS=Homo sapiens OX=9606 GN=CSGALNACT2 PE=1 SV=1
7	AFDB:Q86X52	0.489	0.330	1.223E-35	802	0.231	0.153	Q86X52.pdb.gz	CHSS1_HUMAN Chondroitin sulfate synthase 1 OS=Homo sapiens OX=9606 GN=CHSY1 PE=1 SV=3
8	AFDB:Q5DTK1	0.467	0.288	2.445E-35	884	0.242	0.146	Q5DTK1.pdb.gz	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
9	AFDB:Q6P296	0.480	0.324	5.814E-35	801	0.246	0.164	Q6P296.pdb.gz	Q6P296_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=chys1 PE=2 SV=1
10	AFDB:Q7Z1Z1	0.460	0.338	1.051E-32	736	0.207	0.149	Q7Z1Z1.pdb.gz	CHSSA_CAEEL Chondroitin sulfate synthase sqv-5 OS=Caenorhabditis elegans OX=6239 GN=sqv-5 PE=1 SV=1
11	PDB:2d7iA	0.306	0.303	1.088E-7	536	0.056	0.056	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
12	PDB:6h0bB	0.301	0.306	8.207E-7	521	0.075	0.077	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.
13	PDB:4d0tA	0.283	0.302	8.695E-7	496	0.056	0.060	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
14	PDB:6iwqA	0.284	0.277	1.380E-6	546	0.058	0.057	6iwqA.pdb.gz	Structural basis of carbohydrate transfer activity of UDP-GalNAc: Polypeptide N-acetylgalactosaminyltransferase 7.
15	PDB:6pxuB	0.288	0.288	1.549E-6	532	0.070	0.070	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
16	PDB:4d11C	0.268	0.322	1.951E-6	436	0.066	0.080	4d11C.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N- Acetylgalactosaminyltransferase 2.
17	PDB:4fixA	0.301	0.260	1.238E-5	629	0.068	0.057	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
18	PDB:4y63A	0.224	0.390	1.965E-5	282	0.071	0.135	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
19	PDB:5mlzA	0.262	0.374	3.120E-5	355	0.056	0.085	5mlzA.pdb.gz	Structural basis for dolichylphosphate mannose biosynthesis.
20	PDB:4hg6A	0.255	0.192	5.888E-5	747	0.060	0.043	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F6G2	0.0	773	580	0.712	0.653	E7F6G2_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=csgalnact1a PE=3 SV=1
2	Q8BJQ9	0.0	1002	530	0.900	0.904	CGAT1_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Csgalnact1 PE=2 SV=1
3	Q8C1F4	0.0	662	542	0.592	0.581	CGAT2_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=Csgalnact2 PE=2 SV=1
4	Q8N6G5	0.0	668	542	0.594	0.583	CGAT2_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=CSGALNACT2 PE=1 SV=1
5	Q8TDX6	0.0	1115	532	1.000	1.000	CGAT1_HUMAN Chondroitin sulfate N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=CSGALNACT1 PE=1 SV=2
6	A0A0S2Z5K4	5.80e-137	404	416	0.376	0.481	A0A0S2Z5K4_HUMAN Hexosyltransferase OS=Homo sapiens OX=9606 GN=CSGALNACT2 PE=1 SV=1
7	A1Z863	1.14e-114	352	540	0.387	0.381	A1Z863_DROME Hexosyltransferase OS=Drosophila melanogaster OX=7227 GN=Csgalnact PE=2 SV=1
8	Q5DTK1	1.34e-59	214	884	0.212	0.128	CHSS3_MOUSE Chondroitin sulfate synthase 3 OS=Mus musculus OX=10090 GN=Chsy3 PE=2 SV=3
9	Q70JA7	1.96e-58	210	882	0.209	0.126	CHSS3_HUMAN Chondroitin sulfate synthase 3 OS=Homo sapiens OX=9606 GN=CHSY3 PE=2 SV=3
10	Q6ZQ11	8.32e-54	196	800	0.199	0.133	CHSS1_MOUSE Chondroitin sulfate synthase 1 OS=Mus musculus OX=10090 GN=Chsy1 PE=2 SV=2
11	Q6P296	7.32e-52	191	801	0.179	0.119	Q6P296_DANRE Hexosyltransferase OS=Danio rerio OX=7955 GN=chys1 PE=2 SV=1
12	Q86X52	7.57e-51	188	802	0.201	0.133	CHSS1_HUMAN Chondroitin sulfate synthase 1 OS=Homo sapiens OX=9606 GN=CHSY1 PE=1 SV=3
13	D3ZRM3	1.73e-50	187	799	0.201	0.134	D3ZRM3_RAT Hexosyltransferase OS=Rattus norvegicus OX=10116 GN=Chsy1 PE=3 SV=3
14	Q7Z1Z1	3.58e-33	136	736	0.154	0.111	CHSSA_CAEEL Chondroitin sulfate synthase sqv-5 OS=Caenorhabditis elegans OX=6239 GN=sqv-5 PE=1 SV=1
15	Q6L9W6	7.96e-20	95.9	998	0.109	0.058	B4GN3_HUMAN Beta-1,4-N-acetylgalactosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B4GALNT3 PE=1 SV=2
16	Q76KP1	1.22e-18	92.0	1039	0.109	0.056	B4GN4_HUMAN N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALNT4 PE=1 SV=1
17	Q8IZ52	7.82e-12	70.5	775	0.182	0.125	CHSS2_HUMAN Chondroitin sulfate synthase 2 OS=Homo sapiens OX=9606 GN=CHPF PE=1 SV=2
18	Q6IQX7	3.65e-09	62.0	774	0.173	0.119	CHSS2_MOUSE Chondroitin sulfate synthase 2 OS=Mus musculus OX=10090 GN=Chpf PE=1 SV=1
19	Q8VCJ5	2.93e-05	49.3	551	0.167	0.162	Q8VCJ5_MOUSE Hexosyltransferase (Fragment) OS=Mus musculus OX=10090 GN=Chpf2 PE=2 SV=1
20	Q3UU43	5.04e-05	48.5	768	0.167	0.116	Q3UU43_MOUSE Hexosyltransferase OS=Mus musculus OX=10090 GN=Chpf2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05679 CHGN	1.9e-82	289.4	Chondroitin N-acetylgalactosaminyltransferase
2	PF10111 Glyco_tranf_2_2	6.8	17.7	Glycosyltransferase like family 2
3	PF02709 Glyco_transf_7C	1.8e-05	35.7	N-terminal domain of galactosyltransferase
4	PF07352 Phage_Mu_Gam	1.9e+02	13.4	Bacteriophage Mu Gam like protein
5	PF04612 T2SSM	4.1e+02	12.5	Type II secretion system (T2SS), protein M

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411816

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265471	0.956	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
2	9606.ENSP00000252575	0.944	Neurocan core protein
3	9606.ENSP00000331210	0.940	Brevican core protein
4	9606.ENSP00000243776	0.938	Chondroitin sulfate synthase 2
5	9606.ENSP00000265077	0.936	Versican core protein
6	9606.ENSP00000035307	0.934	Chondroitin sulfate glucuronyltransferase
7	9606.ENSP00000327336	0.923	Biglycan
8	9606.ENSP00000254190	0.920	Chondroitin sulfate synthase 1
9	9606.ENSP00000052754	0.918	Decorin
10	9606.ENSP00000302629	0.915	Chondroitin sulfate synthase 3
11	9606.ENSP00000312506	0.909	Chondroitin sulfate proteoglycan 4
12	9606.ENSP00000373244	0.900	Chondroitin sulfate proteoglycan 5
13	9606.ENSP00000363590	0.885	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
14	9606.ENSP00000307297	0.755	Carbohydrate sulfotransferase 14
15	9606.ENSP00000276055	0.726	Carbohydrate sulfotransferase 7
16	9606.ENSP00000305725	0.720	Carbohydrate sulfotransferase 11
17	9606.ENSP00000481912	0.695	Carbohydrate sulfotransferase 12
18	9606.ENSP00000362207	0.684	Carbohydrate sulfotransferase 3
19	9606.ENSP00000356433	0.675	Uronyl 2-sulfotransferase
20	9606.ENSP00000402394	0.647	Carbohydrate sulfotransferase 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047238	1.000	glucuronosyl-N-acetylgalactosaminyl-proteoglycan 4-beta-N-acetylgalactosaminyltransferase activity
GO:0005515	0.999	protein binding
GO:0015020	0.990	glucuronosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1903510	0.997	mucopolysaccharide metabolic process
GO:0044260	0.995	cellular macromolecule metabolic process
GO:0019538	0.995	protein metabolic process
GO:0006024	0.993	glycosaminoglycan biosynthetic process
GO:0044272	0.990	sulfur compound biosynthetic process
GO:0050650	0.989	chondroitin sulfate proteoglycan biosynthetic process
GO:0030204	0.979	chondroitin sulfate metabolic process
GO:0005975	0.384	carbohydrate metabolic process
GO:0016051	0.321	carbohydrate biosynthetic process
GO:0030206	0.311	chondroitin sulfate biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005794	1.000	Golgi apparatus
GO:0016020	0.985	membrane
GO:0031090	0.927	organelle membrane
GO:0000139	0.892	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.175	1.000	acetylgalactosaminyltransferase.
RHEA:21032	0.990	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	0.990	glucuronosyltransferase.

[back to server]