StarFunc result for job id Q8TDX7

User Input

>input (302 residues)
MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPV
ALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLS
RMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDL
GLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDK
MNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTA
SS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZBE5	0.970	0.970	2.731E-53	302	0.980	0.980	D3ZBE5.pdb.gz	NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus OX=10116 GN=Nek7 PE=1 SV=1
2	AFDB:A0A024R8A6	0.900	0.869	3.001E-44	313	0.785	0.757	A0A024R8A6.pdb.gz
3	PDB:6s73A	0.827	0.923	6.995E-41	269	0.877	0.985	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
4	AFDB:G5EFM9	0.899	0.899	5.537E-39	302	0.672	0.672	G5EFM9.pdb.gz	NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans OX=6239 GN=nekl-3 PE=1 SV=1
5	AFDB:Q55BN8	0.797	0.586	1.911E-25	418	0.325	0.234	Q55BN8.pdb.gz	NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum OX=44689 GN=nek2 PE=1 SV=1
6	AFDB:Q7ZUN2	0.810	0.567	7.710E-25	440	0.325	0.223	Q7ZUN2.pdb.gz	Q7ZUN2_DANRE NIMA (Never in mitosis gene a)-related kinase 2 OS=Danio rerio OX=7955 GN=zgc:55602 PE=2 SV=1
7	AFDB:O35942	0.807	0.560	2.648E-24	443	0.321	0.219	O35942.pdb.gz	NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus OX=10090 GN=Nek2 PE=1 SV=2
8	AFDB:X1WHD3	0.808	0.866	3.282E-24	281	0.344	0.370	X1WHD3.pdb.gz
9	AFDB:P51955	0.794	0.551	4.292E-24	445	0.318	0.216	P51955.pdb.gz	NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens OX=9606 GN=NEK2 PE=1 SV=1
10	AFDB:P51957	0.801	0.298	5.042E-24	841	0.331	0.119	P51957.pdb.gz	NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2
11	AFDB:Q90XC2	0.806	0.361	6.593E-24	697	0.331	0.143	Q90XC2.pdb.gz	NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio OX=7955 GN=nek8 PE=2 SV=1
12	PDB:4d28C	0.761	0.820	1.922E-18	279	0.255	0.276	4d28C.pdb.gz
13	PDB:3eqdA	0.727	0.700	4.074E-18	315	0.281	0.270	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
14	PDB:4ek6A	0.700	0.755	6.967E-18	279	0.291	0.315	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
15	PDB:4gcjA	0.693	0.689	7.756E-18	304	0.298	0.296	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
16	PDB:4c0tA	0.692	0.716	1.558E-17	291	0.219	0.227	4c0tA.pdb.gz
17	PDB:4cztD	0.751	0.751	2.150E-17	302	0.272	0.272	4cztD.pdb.gz
18	PDB:5u6yA	0.711	0.480	8.673E-17	459	0.228	0.150	5u6yA.pdb.gz
19	PDB:4eomC	0.688	0.747	1.263E-16	276	0.295	0.322	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:2bujA	0.715	0.740	1.483E-16	291	0.225	0.234	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZBE5	0.0	625	302	0.980	0.980	NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus OX=10116 GN=Nek7 PE=1 SV=1
2	Q8TDX7	0.0	635	302	1.000	1.000	NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens OX=9606 GN=NEK7 PE=1 SV=1
3	Q9ES74	0.0	625	302	0.977	0.977	NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus OX=10090 GN=Nek7 PE=1 SV=1
4	Q9ES70	1.84e-179	499	313	0.781	0.754	NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus OX=10090 GN=Nek6 PE=1 SV=1
5	Q9HC98	4.72e-179	498	313	0.791	0.764	NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=2
6	G5EFM9	2.00e-153	432	302	0.666	0.666	NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans OX=6239 GN=nekl-3 PE=1 SV=1
7	Q5TBH1	2.64e-118	341	222	0.553	0.752	Q5TBH1_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
8	Q5TBH2	1.80e-116	336	220	0.546	0.750	Q5TBH2_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
9	Q5TBG7	1.76e-115	333	219	0.543	0.749	Q5TBG7_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
10	Q5TBG1	2.48e-105	307	207	0.503	0.734	Q5TBG1_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
11	Q5TBG2	7.73e-78	236	171	0.387	0.684	Q5TBG2_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
12	Q5TBG4	1.04e-67	211	194	0.351	0.546	Q5TBG4_HUMAN NIMA related kinase 6 (Fragment) OS=Homo sapiens OX=9606 GN=NEK6 PE=1 SV=1
13	Q55BN8	2.33e-59	197	418	0.325	0.234	NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum OX=44689 GN=nek2 PE=1 SV=1
14	Q5M813	1.83e-58	191	309	0.331	0.324	Q5M813_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=2 SV=1
15	P51957	7.76e-55	192	841	0.334	0.120	NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens OX=9606 GN=NEK4 PE=1 SV=2
16	A0A8I5ZKL8	1.02e-54	191	743	0.334	0.136	A0A8I5ZKL8_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
17	D3ZDV9	1.57e-54	191	793	0.334	0.127	D3ZDV9_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=4 SV=2
18	A0A8I5ZLB3	1.83e-54	190	756	0.334	0.134	A0A8I5ZLB3_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
19	A0A8I6A574	2.25e-54	191	829	0.334	0.122	A0A8I6A574_RAT NIMA-related kinase 4 OS=Rattus norvegicus OX=10116 GN=Nek4 PE=1 SV=1
20	P51954	2.88e-54	192	1203	0.331	0.083	NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus OX=10090 GN=Nek1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	2.3	18.8	ABC1 atypical kinase-like domain
2	PF03745 DUF309	4.5e+02	12.0	Domain of unknown function (DUF309)
3	PF12330 Haspin_kinase	6	17.3	Haspin like kinase domain
4	PF06293 Kdo	32	15.4	Lipopolysaccharide kinase (Kdo/WaaP) family
5	PF14531 Kinase-like	0.031	25.2	Kinase-like
6	PF12260 PIP49_C	11	17.1	Protein-kinase domain of FAM69
7	PF00069 Pkinase	1.7e-61	219.5	Protein kinase domain
8	PF17667 Pkinase_fungal	1.3	19.4	Fungal protein kinase
9	PF07714 PK_Tyr_Ser-Thr	3.4e-44	162.6	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000021946

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000005171	0.997	NLR family, pyrin domain containing 3
2	61853.ENSNLEP00000019954	0.954	NIMA-related kinase 9
3	61853.ENSNLEP00000020966	0.896	NIMA-related kinase 6
4	61853.ENSNLEP00000021218	0.872	NLR family, pyrin domain containing 14
5	61853.ENSNLEP00000012042	0.736	Ankyrin repeat and sterile alpha motif domain containing 3
6	61853.ENSNLEP00000020213	0.646	Echinoderm microtubule associated protein like 4
7	61853.ENSNLEP00000021010	0.644	Uncharacterized protein
8	61853.ENSNLEP00000007746	0.612	Nucleoporin 37kDa
9	61853.ENSNLEP00000017555	0.609	Nucleoporin 133kDa
10	61853.ENSNLEP00000024388	0.609	Nuclear pore complex protein Nup93
11	61853.ENSNLEP00000003574	0.606	NIMA-related kinase 8
12	61853.ENSNLEP00000008600	0.605	Ribonucleic acid export 1
13	61853.ENSNLEP00000016432	0.605	Nucleoporin 205kDa
14	61853.ENSNLEP00000019161	0.601	Family with sequence similarity 163, member A
15	61853.ENSNLEP00000021913	0.601	Translocated promoter region, nuclear basket protein
16	61853.ENSNLEP00000009128	0.596	RAN binding protein 2
17	61853.ENSNLEP00000020207	0.571	UDP-glucose glycoprotein glucosyltransferase 2
18	61853.ENSNLEP00000003073	0.559	acyl-CoA thioesterase 13
19	61853.ENSNLEP00000020031	0.552	BICD cargo adaptor 2
20	61853.ENSNLEP00000010645	0.504	RCC1 like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0098772	0.825	molecular function regulator activity
GO:0140677	0.798	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0048522	0.983	positive regulation of cellular process
GO:0051128	0.979	regulation of cellular component organization
GO:0044087	0.974	regulation of cellular component biogenesis
GO:0071840	0.940	cellular component organization or biogenesis
GO:0016043	0.929	cellular component organization
GO:0051130	0.902	positive regulation of cellular component organization
GO:0033044	0.852	regulation of chromosome organization
GO:0071704	0.840	organic substance metabolic process
GO:0050896	0.834	response to stimulus
GO:0006996	0.829	organelle organization
GO:0019222	0.778	regulation of metabolic process
GO:0043170	0.772	macromolecule metabolic process
GO:0007049	0.769	cell cycle
GO:0010638	0.760	positive regulation of organelle organization
GO:0044237	0.757	cellular metabolic process
GO:0051726	0.752	regulation of cell cycle
GO:0006807	0.738	nitrogen compound metabolic process
GO:0007017	0.736	microtubule-based process
GO:0043254	0.725	regulation of protein-containing complex assembly
GO:0060255	0.703	regulation of macromolecule metabolic process
GO:0031334	0.690	positive regulation of protein-containing complex assembly
GO:0031323	0.685	regulation of cellular metabolic process
GO:0022607	0.665	cellular component assembly
GO:0051171	0.648	regulation of nitrogen compound metabolic process
GO:0080090	0.645	regulation of primary metabolic process
GO:0022402	0.624	cell cycle process
GO:1901564	0.613	organonitrogen compound metabolic process
GO:0044238	0.601	primary metabolic process
GO:0007051	0.549	spindle organization
GO:0140694	0.529	non-membrane-bounded organelle assembly
GO:0006793	0.471	phosphorus metabolic process
GO:0019219	0.471	regulation of nucleobase-containing compound metabolic process
GO:0051716	0.469	cellular response to stimulus
GO:0031326	0.421	regulation of cellular biosynthetic process
GO:0051052	0.420	regulation of DNA metabolic process
GO:0010556	0.418	regulation of macromolecule biosynthetic process
GO:0010604	0.414	positive regulation of macromolecule metabolic process
GO:0019538	0.342	protein metabolic process
GO:0048583	0.325	regulation of response to stimulus
GO:2000278	0.323	regulation of DNA biosynthetic process
GO:0065009	0.306	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0005829	0.948	cytosol
GO:0032991	0.933	protein-containing complex
GO:0016020	0.832	membrane
GO:0043228	0.626	non-membrane-bounded organelle
GO:0043232	0.601	intracellular non-membrane-bounded organelle
GO:0012505	0.325	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]