StarFunc result for job id Q8TDX9

User Input

>input (1400 residues)
MAEEAAQNISDDQERCLQAACCLSFGGELSVSTDKSWGLHLCSCSPPGGGLWVEVYANHV
LLMSDGKCGCPWCALNGKAEDRESQSPSSSASRQKNIWKTTSEAALSVVNEKTQAVVNEK
TQAPLDCDNSADRIPHKPFIIIARAWSSGGPRFHHRRLCATGTADSTFSALLQLQGTTSA
AAPCSLKMEASCCVLRLLCCAEDVATGLLPGTVTMETPTKVARPTQTSSQRVPLWPISHF
PTSPRSSHGLPPGIPRTPSFTASQSGSEILYPPTQHPPVAILARNSDNFMNPVLNCSLEV
EARAPPNLGFRVHMASGEALCLMMDFGDSSGVEMRLHNMSEAMAVTAYHQYSKGIFFHLL
HFQLDMSTYKEAETQNTTLNVYLCQSENSCLEDSDPSNLGYELISAFVTKGVYMLKAVIY
NEFHGTEVELGPYYVEIGHEAVSAFMNSSSVHEDEVLVFADSQVNQKSTVVIHHFPSIPS
YNVSFISQTQVGDSQAWHSMTVWYKMQSVSVYTNGTVFATDTDITFTAVTKETIPLEFEW
YFGEDPPVRTTSRSIKKRLSIPQWYRVMVKASNRMSSVVSEPHVIRVQKKIVANRLTSPS
SALVNASVAFECWINFGTDVAYLWDFGDGTVSLGSSSSSHVYSREGEFTVEVLAFNNVSA
STLRQQLFIVCEPCQPPLVKNMGPGKVQIWRSQPVRLGVTFEAAVFCDISQGLSYTWNLM
DSEGLPVSLPAAVDTHRQTLILPSHTLEYGNYTALAKVQIEGSVVYSNYCVGLEVRAQAP
VSVISEGTHLFFSRTTSSPIVLRGTQSFDPDDPGATLRYHWECATAGSPAHPCFDSSTAH
QLDAAAPTVSFEAQWLSDSYDQFLVMLRVSSGGRNSSETRVFLSPYPDSAFRFVHISWVS
FKDTFVNWNDELSLQAMCEDCSEIPNLSYSWDLFLVNATEKNRIEVPFCRVVGLLGSLGL
GAISESSQLNLLPTEPGTADPDATTTPFSREPSPVTLGQPATSAPRGTPTEPMTGVYWIP
PAGDSAVLGEAPEEGSLDLEPGPQSKGSLMTGRSERSQPTHSPDPHLSDFEAYYSDIQEA
IPSGGRQPAKDTSFPGSGPSLSAEESPGDGDNLVDPSLSAGRAEPVLMIDWPKALLGRAV
FQGYSSSGITEQTVTIKPYSLSSGETYVLQVSVASKHGLLGKAQLYLTVNPAPRDMACQV
QPHHGLEAHTVFSVFCMSGKPDFHYEFSYQIGNTSKHTLYHGRDTQYYFVLPAGEHLDNY
KVMVSTEITDGKGSKVQPCTVVVTVLPRYHGNDCLGEDLYNSSLKNLSTLQLMGSYTEIR
NYITVITRILSRLSKEDKTASCNQWSRIQDALISSVCRLAFVDQEEMIGSVLMLRDLVSF
SNKLGFMSAVLILKYTRALL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7YZW3	0.092	0.070	1.225E-17	2064	0.122	0.083	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
2	AFDB:Q3V1M1	0.084	0.058	3.059E-17	2594	0.119	0.064	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
3	AFDB:E9Q4Y4	0.078	0.054	3.386E-17	2514	0.139	0.078	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
4	PDB:7q5zA	0.091	0.095	5.983E-15	1344	0.076	0.079	7q5zA.pdb.gz
5	PDB:7q1yA	0.091	0.093	9.455E-15	1374	0.081	0.083	7q1yA.pdb.gz
6	PDB:1e07A	0.102	0.198	1.283E-14	642	0.059	0.128	1e07A.pdb.gz
7	PDB:6h03A	0.083	0.090	2.133E-14	1223	0.061	0.070	6h03A.pdb.gz
8	PDB:7nycA	0.083	0.078	7.490E-13	1542	0.072	0.065	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
9	PDB:5oj2B	0.113	0.176	1.125E-12	692	0.060	0.121	5oj2B.pdb.gz
10	PDB:4ziqA	0.084	0.082	6.022E-12	1450	0.061	0.059	4ziqA.pdb.gz
11	PDB:7sqcO0	0.088	0.100	8.170E-12	1140	0.067	0.082	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:5a42A	0.092	0.083	1.001E-11	1597	0.071	0.063	5a42A.pdb.gz
13	PDB:4lnvA	0.099	0.106	2.500E-11	1276	0.057	0.063	4lnvA.pdb.gz
14	AFDB:Q54NE5	0.073	0.058	4.081E-9	1918	0.094	0.069	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
15	AFDB:F1R2D2	0.122	0.103	1.004E-7	1687	0.095	0.079	F1R2D2.pdb.gz
16	AFDB:G5EBF1	0.110	0.119	7.672E-7	1273	0.069	0.076	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
17	AFDB:A0A0A6YWY8	0.085	0.095	1.095E-6	1203	0.079	0.092	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
18	AFDB:O55005	0.118	0.102	2.599E-6	1651	0.091	0.077	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
19	AFDB:B2RY69	0.082	0.090	7.953E-6	1237	0.086	0.097	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
20	AFDB:A0A2R8QME5	0.086	0.103	1.135E-5	1094	0.058	0.074	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R526	0.0	1369	2615	0.504	0.270	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2
2	Q8TDX9	0.0	2900	2849	1.000	0.491	PK1L1_HUMAN Polycystin-1-like protein 1 OS=Homo sapiens OX=9606 GN=PKD1L1 PE=1 SV=1
3	E7FKV8	1.54e-142	486	2742	0.236	0.121	PK1L1_ORYLA Polycystin-1-like protein 1 OS=Oryzias latipes OX=8090 GN=pkd1l1 PE=1 SV=2
4	P98161	6.70e-15	83.2	4303	0.071	0.023	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
5	Q9ERV0	9.02e-14	79.3	4283	0.071	0.023	Q9ERV0_RAT Pkd1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
6	O08852	4.24e-13	77.4	4293	0.064	0.021	PKD1_MOUSE Polycystin-1 OS=Mus musculus OX=10090 GN=Pkd1 PE=1 SV=2
7	F1MAD3	4.31e-13	77.4	4292	0.071	0.023	F1MAD3_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=3
8	A0A8I6AC84	5.60e-13	77.0	4254	0.071	0.023	A0A8I6AC84_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=1
9	Q46085	0.001	45.8	1021	0.016	0.023	COLH_HATHI Collagenase ColH OS=Hathewaya histolytica OX=1498 GN=colH PE=1 SV=1
10	Q9X721	0.001	46.2	1118	0.023	0.029	COLG_HATHI Collagenase ColG OS=Hathewaya histolytica OX=1498 GN=colG PE=1 SV=1
11	Q9Z0T6	0.012	42.7	2126	0.053	0.035	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
12	Q60696	0.18	38.5	626	0.018	0.040	PMEL_MOUSE Melanocyte protein PMEL OS=Mus musculus OX=10090 GN=Pmel PE=1 SV=2
13	P40541	0.44	37.7	1150	0.018	0.022	SCC3_YEAST Cohesin subunit SCC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRR1 PE=1 SV=1
14	Q38FB7	0.54	37.0	702	0.021	0.043	Q38FB7_TRYB2 Fatty acyl CoA synthetase 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2840 PE=4 SV=1
15	Q9U401	0.54	37.0	702	0.021	0.043	Q9U401_9TRYP Fatty acyl CoA synthetase 4 OS=Trypanosoma brucei OX=5691 GN=ACS4 PE=4 SV=1
16	Q38FB8	1.2	35.8	702	0.021	0.043	Q38FB8_TRYB2 Fatty acyl CoA synthetase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2810 PE=4 SV=1
17	Q9U402	1.2	35.8	702	0.021	0.043	Q9U402_9TRYP Fatty acyl CoA synthetase 3 OS=Trypanosoma brucei OX=5691 GN=ACS3 PE=4 SV=1
18	Q98917	2.2	35.0	763	0.016	0.029	PMEL_CHICK Melanocyte protein PMEL OS=Gallus gallus OX=9031 GN=PMEL PE=1 SV=3
19	A0A0A0MTR7	3.8	34.7	5207	0.031	0.008	A0A0A0MTR7_HUMAN Ring finger protein 213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=1
20	Q63HN8	3.8	34.7	5207	0.031	0.008	RN213_HUMAN E3 ubiquitin-protein ligase RNF213 OS=Homo sapiens OX=9606 GN=RNF213 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00801 PKD	1.9e-18	77.4	PKD domain
2	PF18911 PKD_4	4.5e-06	38.0	PKD domain
3	PF02010 REJ	2e-42	157.2	REJ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289672

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485105	0.867	Polycystic kidney disease protein 1-like 2
2	9606.ENSP00000275364	0.621	Guanine nucleotide-binding protein subunit alpha-12
3	9606.ENSP00000323155	0.614	DAN domain family member 5
4	9606.ENSP00000333568	0.584	Serine/threonine-protein kinase D1
5	9606.ENSP00000312999	0.576	Guanine nucleotide-binding protein G(i) subunit alpha-2
6	9606.ENSP00000339449	0.540	Cilia- and flagella-associated protein 52
7	9606.ENSP00000220809	0.539	Tissue-type plasminogen activator
8	9606.ENSP00000343027	0.520	Guanine nucleotide-binding protein G(i) subunit alpha-1
9	9606.ENSP00000359170	0.506	Protein DPCD

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005262	1.000	calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.912	response to stimulus
GO:0051606	0.867	detection of stimulus
GO:0032501	0.664	multicellular organismal process
GO:0007275	0.580	multicellular organism development
GO:0009799	0.470	specification of symmetry
GO:0060972	0.451	left/right pattern formation
GO:0009855	0.451	determination of bilateral symmetry
GO:0007368	0.424	determination of left/right symmetry
GO:0009987	0.386	cellular process
GO:0048731	0.336	system development
GO:0009798	0.304	axis specification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	1.000	cilium
GO:0016020	0.996	membrane
GO:0032991	0.953	protein-containing complex
GO:0098796	0.854	membrane protein complex
GO:0034702	0.724	ion channel complex
GO:0005622	0.696	intracellular anatomical structure
GO:0043229	0.630	intracellular organelle
GO:0043231	0.546	intracellular membrane-bounded organelle
GO:0034703	0.532	cation channel complex
GO:0071944	0.504	cell periphery
GO:0005886	0.471	plasma membrane
GO:0097730	0.360	non-motile cilium
GO:0034704	0.354	calcium channel complex
GO:0005737	0.320	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]