StarFunc result for job id Q8TDY2

User Input

>input (1594 residues)
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVC
TYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQ
LALEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQ
SIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEDSEKAEMKRSTEL
VLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRESCQSTVHQQDETTIDTKDGD
LPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQTIAKLDNQNMK
AIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQL
MIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELL
ERVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGK
LFRKSFLRNRLFRGLDSWPPSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVP
LLCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKASVSQTSPQSASSPRMESTA
GITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTFDFETIPHPNIEQTIHQVSLD
LDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVINAIDSRRMQDT
NVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCT
AVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELV
CLEEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLE
DLKKLHVENDEKLQLLRAELQSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKE
NQQIINQIQESHAEIIQEKEKQLQELKLKVSDLSDTRCKLEVELALKEAETDEIKILLEE
SRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQVGLAELRTLMTIEKDQCISEL
ISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSALERQKDEKITQ
QEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKEL
LEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNV
RTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLE
EKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMET
SMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRD
FQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVM
EKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FFM2	0.385	0.378	0.000	1622	0.615	0.604	E7FFM2.pdb.gz	E7FFM2_DANRE RB1-inducible coiled-coil 1 OS=Danio rerio OX=7955 GN=rb1cc1 PE=1 SV=2
2	AFDB:Q8TDY2	1.000	1.000	0.000	1594	1.000	1.000	Q8TDY2.pdb.gz	RBCC1_HUMAN RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1 PE=1 SV=3
3	AFDB:Q9ESK9	0.372	0.373	0.000	1588	0.892	0.895	Q9ESK9.pdb.gz	RBCC1_MOUSE RB1-inducible coiled-coil protein 1 OS=Mus musculus OX=10090 GN=Rb1cc1 PE=1 SV=3
4	AFDB:Q7KTS2	0.334	0.387	9.850E-45	1357	0.205	0.241	Q7KTS2.pdb.gz	Q7KTS2_DROME Autophagy-related 17, isoform B OS=Drosophila melanogaster OX=7227 GN=Atg17 PE=2 SV=1
5	AFDB:Q9SUG7	0.204	0.266	9.326E-18	1148	0.082	0.114	Q9SUG7.pdb.gz	ATG11_ARATH Autophagy-related protein 11 OS=Arabidopsis thaliana OX=3702 GN=ATG11 PE=1 SV=1
6	PDB:6o8bB	0.147	0.310	2.075E-6	657	0.029	0.070	6o8bB.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
7	PDB:4im0A	0.144	0.333	9.002E-6	619	0.032	0.082	4im0A.pdb.gz	Structure and ubiquitination-dependent activation of TANK-binding kinase 1.
8	PDB:6o8cA	0.137	0.307	1.969E-5	636	0.033	0.083	6o8cA.pdb.gz	A conserved PLPLRT/SD motif of STING mediates the recruitment and activation of TBK1.
9	AFDB:Q9BZF9	0.071	0.078	3.013E-4	1416	0.124	0.140	Q9BZF9.pdb.gz	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
10	AFDB:Q8CGB3	0.083	0.092	3.650E-3	1411	0.125	0.142	Q8CGB3.pdb.gz	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
11	AFDB:Q382P4	0.062	0.074	6.565E-3	1299	0.125	0.154	Q382P4.pdb.gz	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
12	AFDB:O94488	0.052	0.072	1.925E-2	1115	0.103	0.147	O94488.pdb.gz	MBO1_SCHPO Microtubule organizer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mbo1 PE=1 SV=1
13	PDB:6yvaC	0.046	0.426	1.946E-2	155	0.009	0.097	6yvaC.pdb.gz
14	AFDB:Q8TES7	0.069	0.096	2.342E-2	1133	0.091	0.128	Q8TES7.pdb.gz	FBF1_HUMAN Fas-binding factor 1 OS=Homo sapiens OX=9606 GN=FBF1 PE=1 SV=2
15	PDB:3dbhI	0.042	0.653	3.022E-2	86	0.011	0.209	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
16	PDB:7rbsB	0.046	0.418	3.174E-2	157	0.012	0.121	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
17	PDB:6mdhA	0.041	0.399	9.309E-2	149	0.008	0.081	6mdhA.pdb.gz
18	PDB:1qzeA	0.044	0.305	1.377E-1	214	0.010	0.075	1qzeA.pdb.gz
19	PDB:3ai5A	0.040	0.201	1.674E-1	299	0.013	0.067	3ai5A.pdb.gz
20	PDB:3plvA	0.041	0.695	2.730E-1	80	0.008	0.150	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FFM2	0.0	1419	1622	0.490	0.482	E7FFM2_DANRE RB1-inducible coiled-coil 1 OS=Danio rerio OX=7955 GN=rb1cc1 PE=1 SV=2
2	Q8TDY2	0.0	3255	1594	1.000	1.000	RBCC1_HUMAN RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1 PE=1 SV=3
3	Q9ESK9	0.0	2820	1588	0.892	0.895	RBCC1_MOUSE RB1-inducible coiled-coil protein 1 OS=Mus musculus OX=10090 GN=Rb1cc1 PE=1 SV=3
4	Q7KTS2	5.59e-82	299	1357	0.132	0.155	Q7KTS2_DROME Autophagy-related 17, isoform B OS=Drosophila melanogaster OX=7227 GN=Atg17 PE=2 SV=1
5	Q22342	1.74e-14	81.6	1338	0.040	0.048	Q22342_CAEEL Autophagy-related protein 11 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=epg-7 PE=1 SV=2
6	Q9JMH9	0.017	42.4	2050	0.058	0.045	MY18A_MOUSE Unconventional myosin-XVIIIa OS=Mus musculus OX=10090 GN=Myo18a PE=1 SV=2
7	Q8TDM6	0.027	42.0	1919	0.050	0.042	DLG5_HUMAN Disks large homolog 5 OS=Homo sapiens OX=9606 GN=DLG5 PE=1 SV=4
8	Q92614	0.11	39.7	2054	0.051	0.039	MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3
9	P08799	0.13	39.7	2116	0.055	0.041	MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum OX=44689 GN=mhcA PE=1 SV=3
10	Q6A162	0.14	38.9	431	0.028	0.104	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
11	Q9Y4B5	0.14	39.3	1905	0.046	0.038	MTCL1_HUMAN Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1 PE=1 SV=5
12	Q6FVW6	0.15	39.3	692	0.030	0.069	Q6FVW6_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=KAR3 PE=1 SV=1
13	Q9NQX4	0.17	39.3	1742	0.072	0.065	MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens OX=9606 GN=MYO5C PE=1 SV=2
14	E7F2X0	0.19	38.9	1569	0.031	0.032	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2
15	Q9Y5S2	0.20	38.9	1711	0.059	0.055	MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2
16	P47037	0.22	38.9	1230	0.045	0.059	SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC3 PE=1 SV=1
17	Q6AW69	0.31	38.1	1297	0.066	0.081	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
18	P48681	0.37	38.1	1621	0.035	0.034	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
19	Q55GG3	0.58	37.4	818	0.046	0.090	Q55GG3_DICDI Ubiquitin-like domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268498 PE=4 SV=2
20	Q5HZI1	0.61	37.4	1210	0.036	0.047	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10377 ATG11	8.4e-22	89.0	Autophagy-related protein 11
2	PF04108 ATG17_like	5e-11	54.2	Autophagy protein ATG17-like domain
3	PF14804 Jag_N	3.1e+02	13.1	Jag N-terminus
4	PF18396 TBK1_ULD	7.8	17.8	TANK binding kinase 1 ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000025008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324560	0.999	Serine/threonine-protein kinase ULK1
2	9606.ENSP00000338990	0.999	Autophagy-related protein 101
3	9606.ENSP00000375872	0.999	Autophagy-related protein 16-1
4	9606.ENSP00000378914	0.999	Serine/threonine-protein kinase ULK2
5	9606.ENSP00000432412	0.999	Autophagy-related protein 13
6	9606.ENSP00000247178	0.996	Beclin 1-associated autophagy-related key regulator
7	9606.ENSP00000262039	0.994	Phosphatidylinositol 3-kinase catalytic subunit type 3
8	9606.ENSP00000269305	0.994	Cellular tumor antigen p53
9	9606.ENSP00000355231	0.994	Beclin-1
10	9606.ENSP00000349205	0.990	Phosphoinositide 3-kinase regulatory subunit 4
11	9606.ENSP00000398523	0.986	Calcium-binding and coiled-coil domain-containing protein 2
12	9606.ENSP00000358072	0.984	Autophagy protein 5
13	9606.ENSP00000482753	0.983	Guanine nucleotide exchange C9orf72
14	9606.ENSP00000425107	0.981	Ubiquitin-like protein ATG12
15	9606.ENSP00000354558	0.979	Serine/threonine-protein kinase mTOR
16	9606.ENSP00000403400	0.979	Cell cycle progression protein 1
17	9606.ENSP00000431926	0.974	Activating molecule in BECN1-regulated autophagy protein 1
18	9606.ENSP00000307272	0.966	Regulatory-associated protein of mTOR
19	9606.ENSP00000306866	0.964	Gamma-aminobutyric acid receptor-associated protein
20	9606.ENSP00000266458	0.960	Gamma-aminobutyric acid receptor-associated protein-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.818	enzyme binding
GO:0019901	0.363	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0016236	0.982	macroautophagy
GO:0006807	0.980	nitrogen compound metabolic process
GO:0071704	0.979	organic substance metabolic process
GO:1901564	0.971	organonitrogen compound metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0071840	0.967	cellular component organization or biogenesis
GO:0044238	0.966	primary metabolic process
GO:0043412	0.965	macromolecule modification
GO:0036211	0.964	protein modification process
GO:0016043	0.962	cellular component organization
GO:0051246	0.947	regulation of protein metabolic process
GO:0048519	0.946	negative regulation of biological process
GO:0048523	0.944	negative regulation of cellular process
GO:0006996	0.933	organelle organization
GO:0031399	0.822	regulation of protein modification process
GO:0006796	0.744	phosphate-containing compound metabolic process
GO:0048518	0.693	positive regulation of biological process
GO:0010556	0.663	regulation of macromolecule biosynthetic process
GO:0031326	0.663	regulation of cellular biosynthetic process
GO:0044085	0.636	cellular component biogenesis
GO:0016310	0.593	phosphorylation
GO:0000045	0.585	autophagosome assembly
GO:0006468	0.552	protein phosphorylation
GO:0048522	0.545	positive regulation of cellular process
GO:0050896	0.520	response to stimulus
GO:0046777	0.473	protein autophosphorylation
GO:0042127	0.467	regulation of cell population proliferation
GO:2000112	0.390	regulation of cellular macromolecule biosynthetic process
GO:0051716	0.376	cellular response to stimulus
GO:0008285	0.373	negative regulation of cell population proliferation
GO:0009893	0.362	positive regulation of metabolic process
GO:0048583	0.358	regulation of response to stimulus
GO:0010646	0.347	regulation of cell communication
GO:0023051	0.326	regulation of signaling
GO:0009894	0.325	regulation of catabolic process
GO:0031325	0.318	positive regulation of cellular metabolic process
GO:0009966	0.309	regulation of signal transduction
GO:0007154	0.304	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000407	0.999	phagophore assembly site
GO:0031090	0.999	organelle membrane
GO:0005634	0.999	nucleus
GO:0005773	0.999	vacuole
GO:1990316	0.999	Atg1/ULK1 kinase complex
GO:0012505	0.994	endomembrane system
GO:0005829	0.991	cytosol
GO:0098588	0.927	bounding membrane of organelle
GO:0005764	0.864	lysosome
GO:0005774	0.842	vacuolar membrane
GO:0043233	0.758	organelle lumen
GO:0031967	0.750	organelle envelope
GO:0005789	0.736	endoplasmic reticulum membrane
GO:0070013	0.698	intracellular organelle lumen
GO:0005776	0.573	autophagosome
GO:0000421	0.550	autophagosome membrane
GO:0031981	0.524	nuclear lumen
GO:0005635	0.489	nuclear envelope
GO:0005654	0.480	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]