StarFunc result for job id Q8TDY3

User Input

>input (377 residues)
MFNPHALDSPAVIFDNGSGFCKAGLSGEFGPRHMVSSIVGHLKFQAPSAEANQKKYFVGE
EALYKQEALQLHSPFERGLITGWDDVERLWKHLFEWELGVKPSDQPLLATEPSLNPRENR
EKMAEVMFENFGVPAFYLSDQAVLALYASACVTGLVVDSGDAVTCTVPIFEGYSLPHAVT
KLHVAGRDITELLMQLLLASGHTFPCQLDKGLVDDIKKKLCYVALEPEKELSRRPEEVLR
EYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEIV
LSGGTTLFHGLDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT
AADFKEFGTSVVQRRCF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TDG2	0.962	0.965	2.154E-62	376	0.753	0.755	Q8TDG2.pdb.gz	ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens OX=9606 GN=ACTRT1 PE=2 SV=2
2	AFDB:P07829	0.941	0.944	1.206E-53	376	0.469	0.471	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
3	AFDB:Q4YU79	0.941	0.944	4.202E-53	376	0.477	0.479	Q4YU79.pdb.gz	ACT2_PLABA Actin-2 OS=Plasmodium berghei (strain Anka) OX=5823 GN=ACT2 PE=1 SV=1
4	AFDB:B6VNT8	0.943	0.943	6.250E-53	377	0.472	0.472	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
5	AFDB:P0CJ46	0.938	0.938	6.250E-53	377	0.462	0.462	P0CJ46.pdb.gz	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
6	AFDB:P10989	0.937	0.942	1.640E-52	375	0.472	0.475	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
7	AFDB:P86287	0.937	0.940	3.061E-52	376	0.477	0.479	P86287.pdb.gz	ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=ACT1 PE=1 SV=1
8	AFDB:Q8RYC2	0.937	0.934	3.429E-52	378	0.443	0.442	Q8RYC2.pdb.gz	ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana OX=3702 GN=ACT5 PE=5 SV=1
9	AFDB:A0A1D8PFR4	0.941	0.943	5.101E-52	376	0.454	0.455	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
10	AFDB:Q9U1E8	0.938	0.940	8.032E-52	376	0.462	0.463	Q9U1E8.pdb.gz	Q9U1E8_LEIMA Actin OS=Leishmania major OX=5664 GN=ACT PE=3 SV=1
11	PDB:1c0gA	0.936	0.959	3.992E-51	368	0.472	0.484	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
12	PDB:1yagA	0.944	0.957	6.436E-50	372	0.467	0.473	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
13	PDB:6tu4A	0.904	0.915	9.575E-50	372	0.472	0.478	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
14	PDB:4cbxA	0.913	0.960	3.050E-48	358	0.467	0.492	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
15	PDB:4pl7A	0.882	0.871	3.758E-44	382	0.448	0.442	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
16	PDB:4a7fA	0.879	0.883	9.147E-40	375	0.475	0.477	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
17	PDB:7nvmK	0.704	0.827	9.418E-34	317	0.435	0.517	7nvmK.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
18	PDB:6w18B	0.845	0.867	4.882E-33	367	0.382	0.392	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
19	PDB:6w17A	0.883	0.876	5.927E-32	380	0.321	0.318	6w17A.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
20	PDB:5i9eC	0.824	0.772	9.332E-32	404	0.286	0.267	5i9eC.pdb.gz	Crystal structure of a nuclear actin ternary complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TDG2	0.0	593	376	0.753	0.755	ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens OX=9606 GN=ACTRT1 PE=2 SV=2
2	P10989	7.03e-133	387	375	0.472	0.475	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
3	P20359	7.49e-132	384	375	0.469	0.472	ACTG_EMENI Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=acnA PE=3 SV=2
4	P29751	1.16e-131	384	375	0.480	0.483	ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus OX=9986 GN=ACTB PE=2 SV=1
5	P10984	1.25e-131	383	376	0.480	0.481	ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans OX=6239 GN=act-2 PE=3 SV=3
6	P60706	1.70e-131	383	375	0.480	0.483	ACTB_CHICK Actin, cytoplasmic 1 OS=Gallus gallus OX=9031 GN=ACTB PE=1 SV=1
7	P60709	1.70e-131	383	375	0.480	0.483	ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1
8	P60710	1.70e-131	383	375	0.480	0.483	ACTB_MOUSE Actin, cytoplasmic 1 OS=Mus musculus OX=10090 GN=Actb PE=1 SV=1
9	P60711	1.70e-131	383	375	0.480	0.483	ACTB_RAT Actin, cytoplasmic 1 OS=Rattus norvegicus OX=10116 GN=Actb PE=1 SV=1
10	P60712	1.70e-131	383	375	0.480	0.483	ACTB_BOVIN Actin, cytoplasmic 1 OS=Bos taurus OX=9913 GN=ACTB PE=1 SV=1
11	Q1KLZ0	1.70e-131	383	375	0.480	0.483	Q1KLZ0_HUMAN HCG15971, isoform CRA_a OS=Homo sapiens OX=9606 GN=PS1TP5BP1 PE=1 SV=1
12	Q58J72	1.70e-131	383	375	0.480	0.483	Q58J72_MELGA Beta-actin OS=Meleagris gallopavo OX=9103 PE=2 SV=1
13	Q6QAQ1	1.70e-131	383	375	0.480	0.483	ACTB_PIG Actin, cytoplasmic 1 OS=Sus scrofa OX=9823 GN=ACTB PE=1 SV=2
14	P60009	1.91e-131	383	375	0.467	0.469	ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ACT1 PE=3 SV=1
15	P60010	1.91e-131	383	375	0.467	0.469	ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACT1 PE=1 SV=1
16	P63259	3.37e-131	382	375	0.477	0.480	ACTG_RAT Actin, cytoplasmic 2 OS=Rattus norvegicus OX=10116 GN=Actg1 PE=1 SV=1
17	P63260	3.37e-131	382	375	0.477	0.480	ACTG_MOUSE Actin, cytoplasmic 2 OS=Mus musculus OX=10090 GN=Actg1 PE=1 SV=1
18	P63261	3.37e-131	382	375	0.477	0.480	ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1
19	P10986	5.46e-131	382	376	0.477	0.479	ACT4_CAEEL Actin-4 OS=Caenorhabditis elegans OX=6239 GN=act-4 PE=3 SV=2
20	Q553U6	6.64e-131	382	376	0.477	0.479	ACT22_DICDI Putative actin-22 OS=Dictyostelium discoideum OX=44689 GN=act22 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	1.7e-108	374.4	Actin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367658

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000399078	0.797	Olfactory receptor 10J1
2	9606.ENSP00000336800	0.741	Kelch-like protein 25
3	9606.ENSP00000320563	0.732	WD repeat- and FYVE domain-containing protein 4
4	9606.ENSP00000326238	0.669	F-actin-capping protein subunit alpha-3
5	9606.ENSP00000369531	0.640	Ubiquilin-like protein
6	9606.ENSP00000330904	0.602	Olfactory receptor 2T34
7	9606.ENSP00000307604	0.588	Zinc finger and BTB domain-containing protein 5
8	9606.ENSP00000313691	0.583	Ferritin, mitochondrial
9	9606.ENSP00000432487	0.570	Protein SAAL1
10	9606.ENSP00000301587	0.561	ATP synthase subunit d, mitochondrial
11	9606.ENSP00000436424	0.554	Olfactory receptor 4D10
12	9606.ENSP00000334996	0.546	Calicin
13	9606.ENSP00000367629	0.504	Rho guanine nucleotide exchange factor 16
14	9606.ENSP00000324527	0.503	Unconventional myosin-Id

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.917	biological regulation
GO:0050794	0.912	regulation of cellular process
GO:0032502	0.658	developmental process
GO:0016043	0.399	cellular component organization
GO:0048856	0.362	anatomical structure development
GO:0019222	0.350	regulation of metabolic process
GO:0031323	0.305	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005634	0.970	nucleus
GO:0043232	0.560	intracellular non-membrane-bounded organelle
GO:0032991	0.341	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]