StarFunc result for job id Q8TDY4

User Input

>input (903 residues)
MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNL
NNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGIPGEVAQ
DMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFI
EKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ
FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGE
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQS
LTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRF
ARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQA
SLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALD
IARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAH
WASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCARHASGDRSEVS
SLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPS
EMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQL
LQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAB1	0.437	0.437	0.000	903	1.000	1.000	A0A024RAB1.pdb.gz
2	AFDB:A1Z7A6	0.300	0.240	4.983E-52	1155	0.369	0.288	A1Z7A6.pdb.gz	ASAP_DROME ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Asap PE=1 SV=1
3	AFDB:A0A0B4LEF8	0.360	0.298	5.934E-52	1143	0.372	0.294	A0A0B4LEF8.pdb.gz	A0A0B4LEF8_DROME ArfGAP with SH3 domain, ankyrin repeat and PH domain, isoform D OS=Drosophila melanogaster OX=7227 GN=Asap PE=4 SV=1
4	PDB:3lvqE	0.281	0.600	4.315E-31	420	0.283	0.610	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
5	AFDB:X2JDY8	0.224	0.199	2.890E-14	1025	0.135	0.119	X2JDY8.pdb.gz	RHGF_DROME Rho GTPase-activating protein Graf OS=Drosophila melanogaster OX=7227 GN=Graf PE=1 SV=1
6	PDB:3ljuX	0.127	0.300	4.922E-7	373	0.048	0.115	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
7	AFDB:O74345	0.134	0.196	2.564E-5	601	0.092	0.138	O74345.pdb.gz	UCP3_SCHPO UBA domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp3 PE=4 SV=1
8	AFDB:Q6DFV3	0.088	0.045	3.053E-5	1944	0.113	0.052	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
9	AFDB:Q9ULJ7	0.123	0.079	9.498E-5	1429	0.092	0.058	Q9ULJ7.pdb.gz	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
10	PDB:3o47A	0.099	0.292	1.708E-4	289	0.042	0.131	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
11	AFDB:Q54DW7	0.105	0.097	6.206E-4	986	0.131	0.120	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
12	AFDB:A0A3B3ISP1	0.121	0.094	6.483E-4	1194	0.117	0.089	A0A3B3ISP1.pdb.gz	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
13	PDB:4mk0A	0.103	0.144	1.023E-3	631	0.034	0.049	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
14	PDB:4mt6A	0.096	0.210	1.218E-3	389	0.042	0.098	4mt6A.pdb.gz
15	AFDB:P59672	0.115	0.094	1.303E-3	1150	0.118	0.093	P59672.pdb.gz	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
16	PDB:6ikoA	0.115	0.268	1.582E-3	303	0.041	0.122	6ikoA.pdb.gz
17	PDB:3ehqA	0.120	0.548	1.968E-3	182	0.035	0.176	3ehqA.pdb.gz
18	PDB:6u3eA	0.096	0.206	2.344E-3	397	0.025	0.058	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:6bbpA	0.089	0.149	2.915E-3	520	0.025	0.044	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:6jd6B	0.125	0.543	3.181E-3	192	0.034	0.161	6jd6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43150	0.0	768	1006	0.420	0.377	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
2	O97902	0.0	735	1129	0.404	0.323	ASAP1_BOVIN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Bos taurus OX=9913 GN=ASAP1 PE=1 SV=1
3	Q8TDY4	0.0	1864	903	1.000	1.000	ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ASAP3 PE=1 SV=1
4	Q9QWY8	0.0	724	1147	0.403	0.317	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
5	Q9ULH1	0.0	736	1129	0.405	0.324	ASAP1_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4
6	A0A0B4LEF8	1.51e-168	523	1143	0.339	0.268	A0A0B4LEF8_DROME ArfGAP with SH3 domain, ankyrin repeat and PH domain, isoform D OS=Drosophila melanogaster OX=7227 GN=Asap PE=4 SV=1
7	A1Z7A6	2.99e-168	522	1155	0.339	0.265	ASAP_DROME ArfGAP with SH3 domain, ANK repeat and PH domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Asap PE=1 SV=1
8	Q5FVC7	8.53e-49	188	770	0.163	0.191	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
9	Q6ZQK5	1.23e-48	187	770	0.163	0.191	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
10	A2ADA6	1.54e-48	187	829	0.171	0.186	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
11	Q4QQN0	3.77e-48	184	626	0.165	0.238	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
12	Q15057	4.39e-48	186	778	0.164	0.190	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
13	Q6NXL5	7.03e-48	186	833	0.172	0.186	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
14	Q3UH98	1.65e-47	184	833	0.172	0.186	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	Q15027	4.19e-43	170	740	0.186	0.227	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
16	Q8T0R1	3.70e-37	152	767	0.148	0.175	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
17	Q54WI0	4.06e-37	153	1333	0.168	0.114	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
18	Q9VCQ6	5.29e-37	152	828	0.148	0.162	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
19	Q8MSZ5	1.87e-31	125	235	0.082	0.315	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
20	Q9XXH8	3.76e-30	130	826	0.105	0.115	CNT1_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.0016	30.0	Ankyrin repeat
2	PF12796 Ank_2	6e-07	41.3	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.014	26.7	Ankyrin repeat
4	PF13637 Ank_4	1.6e-05	36.6	Ankyrin repeats (many copies)
5	PF13857 Ank_5	2.2e-06	39.1	Ankyrin repeats (many copies)
6	PF01412 ArfGap	3.1e-28	109.6	Putative GTPase activating protein for Arf
7	PF16746 BAR_3	1.1e-15	69.5	BAR domain of APPL family
8	PF11690 DUF3287	61	14.8	Protein of unknown function (DUF3287)
9	PF00169 PH	1.1e-07	43.6	PH domain
10	PF16652 PH_13	3.5e+02	12.5	Pleckstrin homology domain
11	PF08458 PH_2	76	15.1	Plant pleckstrin homology-like region
12	PF14593 PH_3	1.2e+02	14.2	PH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338769

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298316	0.988	ADP-ribosylation factor 6
2	9606.ENSP00000356042	0.851	Ezrin
3	9606.ENSP00000281419	0.829	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
4	9606.ENSP00000429900	0.828	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
5	9606.ENSP00000300574	0.778	Adapter molecule crk
6	9606.ENSP00000380321	0.687	Tubby-related protein 3
7	9606.ENSP00000347742	0.664	Na(+)/H(+) exchange regulatory cofactor NHE-RF4
8	9606.ENSP00000365351	0.594	Integrin subunit beta like 1
9	9606.ENSP00000483825	0.587	NF-kappa-B essential modulator
10	9606.ENSP00000260746	0.542	ADP-ribosylation factor-like protein 3
11	9606.ENSP00000378868	0.540	APOBEC1 complementation factor
12	9606.ENSP00000276297	0.509	Rho GTPase-activating protein 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0030234	0.995	enzyme regulator activity
GO:0005096	0.991	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050790	0.965	regulation of catalytic activity
GO:0033043	0.923	regulation of organelle organization
GO:0051493	0.881	regulation of cytoskeleton organization
GO:0032970	0.859	regulation of actin filament-based process
GO:0043087	0.857	regulation of GTPase activity
GO:0044087	0.845	regulation of cellular component biogenesis
GO:0032956	0.841	regulation of actin cytoskeleton organization
GO:1902903	0.820	regulation of supramolecular fiber organization
GO:0110020	0.806	regulation of actomyosin structure organization
GO:0032231	0.783	regulation of actin filament bundle assembly
GO:0044093	0.688	positive regulation of molecular function
GO:0043085	0.638	positive regulation of catalytic activity
GO:0048518	0.567	positive regulation of biological process
GO:0048870	0.530	cell motility
GO:0048522	0.528	positive regulation of cellular process
GO:0051345	0.516	positive regulation of hydrolase activity
GO:0071840	0.425	cellular component organization or biogenesis
GO:0016043	0.408	cellular component organization
GO:0016477	0.402	cell migration
GO:0043547	0.387	positive regulation of GTPase activity
GO:0051492	0.313	regulation of stress fiber assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.999	nucleus
GO:0005654	0.994	nucleoplasm
GO:0016020	0.873	membrane
GO:0030054	0.826	cell junction
GO:0120025	0.559	plasma membrane bounded cell projection
GO:0070161	0.500	anchoring junction
GO:0012505	0.494	endomembrane system
GO:0001726	0.485	ruffle
GO:0030055	0.482	cell-substrate junction
GO:0031982	0.404	vesicle
GO:0005925	0.392	focal adhesion
GO:0005886	0.354	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]