StarFunc result for job id Q8TDY8

User Input

>input (1250 residues)
MARGDAGRGRGLLALTFCLLAARGELLLPQETTVELSCGVGPLQVILGPEQAAVLNCSLG
AAAAGPPTRVTWSKDGDTLLEHDHLHLLPNGSLWLSQPLAPNGSDESVPEAVGVIEGNYS
CLAHGPLGVLASQTAVVKLATLADFSLHPESQTVEENGTARFECHIEGLPAPIITWEKDQ
VTLPEEPRLIVLPNGVLQILDVQESDAGPYRCVATNSARQHFSQEALLSVAHRGSLASTR
GQDVVIVAAPENTTVVSGQSVVMECVASADPTPFVSWVRQDGKPISTDVIVLGRTNLLIA
NAQPWHSGVYVCRANKPRTRDFATAAAELRVLAAPAITQAPEALSRTRASTARFVCRASG
EPRPALRWLHNGAPLRPNGRVKVQGGGGSLVITQIGLQDAGYYQCVAENSAGMACAAASL
AVVVREGLPSAPTRVTATPLSSSAVLVAWERPEMHSEQIIGFSLHYQKARGMDNVEYQFA
VNNDTTELQVRDLEPNTDYEFYVVAYSQLGASRTSTPALVHTLDDVPSAAPQLSLSSPNP
SDIRVAWLPLPPSLSNGQVVKYKIEYGLGKEDQIFSTEVRGNETQLMLNSLQPNKVYRVR
ISAGTAAGFGAPSQWMHHRTPSMHNQSHVPFAPAELKVQAKMESLVVSWQPPPHPTQISG
YKLYWREVGAEEEANGDRLPGGRGDQAWDVGPVRLKKKVKQYELTQLVPGRLYEVKLVAF
NKHEDGYAAVWKGKTEKAPAPDMPIQRGPPLPPAHVHAESNSSTSIWLRWKKPDFTTVKI
VNYTVRFSPWGLRNASLVTYYTSSGEDILIGGLKPFTKYEFAVQSHGVDMDGPFGSVVER
STLPDRPSTPPSDLRLSPLTPSTVRLHWCPPTEPNGEIVEYLILYSSNHTQPEHQWTLLT
TQGNIFSAEVHGLESDTRYFFKMGARTEVGPGPFSRLQDVITLQEKLSDSLDMHSVTGII
VGVCLGLLCLLACMCAGLRRSPHRESLPGLSSTATPGNPALYSRARLGPPSPPAAHELES
LVHPHPQDWSPPPSDVEDRAEVHSLMGGGVSEGRSHSKRKISWAQPSGLSWAGSWAGCEL
PQAGPRPALTRALLPPAGTGQTLLLQALVYDAIKGNGRKKSPPACRNQVEAEVIVHSDFS
ASNGNPDLHLQDLEPEDPLPPEAPDLISGVGDPGQGAAWLDRELGGCELAAPGPDRLTCL
PEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97798	0.271	0.229	4.231E-78	1493	0.243	0.204	P97798.pdb.gz	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
2	AFDB:G5EF96	0.265	0.236	1.831E-77	1415	0.235	0.208	G5EF96.pdb.gz	UNC40_CAEEL Netrin receptor unc-40 OS=Caenorhabditis elegans OX=6239 GN=unc-40 PE=1 SV=1
3	AFDB:G5EBF1	0.145	0.142	2.160E-59	1273	0.230	0.225	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
4	AFDB:Q9W213	0.149	0.135	7.102E-59	1395	0.181	0.162	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
5	AFDB:F1R2D2	0.155	0.124	3.217E-58	1687	0.202	0.150	F1R2D2.pdb.gz
6	AFDB:O55005	0.149	0.123	1.457E-57	1651	0.209	0.158	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
7	AFDB:Q9Z2I4	0.145	0.134	4.791E-57	1366	0.217	0.198	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
8	AFDB:Q96MS0	0.138	0.125	1.892E-56	1386	0.210	0.189	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
9	AFDB:A0A2R8QRK0	0.163	0.150	1.181E-55	1420	0.187	0.165	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
10	AFDB:Q9VPZ7	0.144	0.134	3.708E-55	1342	0.193	0.180	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
11	PDB:5oj2B	0.083	0.140	9.534E-23	692	0.106	0.192	5oj2B.pdb.gz
12	PDB:1e07A	0.120	0.190	3.515E-17	642	0.074	0.145	1e07A.pdb.gz
13	PDB:7q1yA	0.089	0.083	1.414E-14	1374	0.076	0.069	7q1yA.pdb.gz
14	PDB:6pxvA	0.131	0.191	2.449E-14	823	0.051	0.078	6pxvA.pdb.gz
15	PDB:7q5zA	0.077	0.072	5.094E-14	1344	0.084	0.078	7q5zA.pdb.gz
16	PDB:6dldD	0.107	0.406	9.669E-14	269	0.050	0.234	6dldD.pdb.gz
17	PDB:5a42A	0.098	0.083	1.273E-13	1597	0.086	0.068	5a42A.pdb.gz
18	PDB:8eyyA	0.130	0.200	1.332E-13	775	0.051	0.083	8eyyA.pdb.gz
19	PDB:7sqcO0	0.137	0.146	2.901E-13	1140	0.090	0.098	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:8dtlA	0.129	0.206	3.484E-13	741	0.049	0.082	8dtlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2EY14	0.0	614	1149	0.298	0.325	PRTGA_DANRE Protogenin A OS=Danio rerio OX=7955 GN=prtga PE=2 SV=1
2	Q2EY15	0.0	658	1191	0.314	0.330	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
3	Q2VWP7	0.0	662	1150	0.316	0.343	PRTG_HUMAN Protogenin OS=Homo sapiens OX=9606 GN=PRTG PE=2 SV=1
4	Q8BQC3	1.73e-114	379	813	0.186	0.287	IGDC3_MOUSE Immunoglobulin superfamily DCC subclass member 3 OS=Mus musculus OX=10090 GN=Igdcc3 PE=2 SV=1
5	P97798	1.09e-71	266	1492	0.211	0.177	NEO1_MOUSE Neogenin OS=Mus musculus OX=10090 GN=Neo1 PE=1 SV=2
6	P97603	7.42e-71	263	1377	0.214	0.194	NEO1_RAT Neogenin (Fragment) OS=Rattus norvegicus OX=10116 GN=Neo1 PE=1 SV=1
7	Q92859	2.69e-69	258	1461	0.212	0.181	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2
8	Q91562	9.01e-69	256	1427	0.214	0.187	Q91562_XENLA Deleted in colorectal carcinoma OS=Xenopus laevis OX=8355 GN=dcc.L PE=1 SV=1
9	Q49BB0	2.10e-66	249	1421	0.206	0.181	Q49BB0_DANRE Deleted in colorectal cancer OS=Danio rerio OX=7955 GN=zdcc PE=1 SV=1
10	Q63155	1.36e-65	246	1445	0.214	0.185	DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 GN=Dcc PE=1 SV=2
11	P70211	1.55e-64	243	1447	0.213	0.184	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
12	A0A0R4IIB3	2.87e-64	242	1409	0.193	0.171	A0A0R4IIB3_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=3 SV=2
13	P43146	6.43e-64	241	1447	0.213	0.184	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
14	A0A0R4IP15	9.86e-63	237	1428	0.195	0.171	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
15	Q3S3D7	1.04e-59	228	1441	0.211	0.183	Q3S3D7_XENBO Neogenin variant 1 OS=Xenopus borealis OX=8354 PE=2 SV=1
16	P16621	4.53e-54	210	2029	0.179	0.110	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
17	A1Z921	6.33e-54	209	1375	0.182	0.165	A1Z921_DROME Frazzled, isoform B OS=Drosophila melanogaster OX=7227 GN=fra PE=1 SV=1
18	Q94537	1.41e-53	208	1375	0.182	0.165	Q94537_DROME Frazzled OS=Drosophila melanogaster OX=7227 GN=fra PE=2 SV=1
19	Q59FP8	1.60e-53	207	1130	0.158	0.174	Q59FP8_HUMAN Neogenin 1 (Fragment) OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=1
20	G5EF96	4.09e-52	203	1415	0.195	0.172	UNC40_CAEEL Netrin receptor unc-40 OS=Caenorhabditis elegans OX=6239 GN=unc-40 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.8e-05	36.0	CD80-like C2-set immunoglobulin domain
2	PF00028 Cadherin	52	15.7	Cadherin domain
3	PF07198 DUF1410	2.5e+02	13.5	Protein of unknown function (DUF1410)
4	PF00041 fn3	4.5e-61	214.5	Fibronectin type III domain
5	PF07679 I-set	3.3e-45	163.4	Immunoglobulin I-set domain
6	PF00047 ig	9.5e-24	94.7	Immunoglobulin domain
7	PF13895 Ig_2	1.4e-26	104.0	Immunoglobulin domain
8	PF13927 Ig_3	7e-46	166.0	Immunoglobulin domain
9	PF17736 Ig_C17orf99	73	14.8	C17orf99 Ig domain
10	PF16706 Izumo-Ig	76	14.7	Izumo-like Immunoglobulin domain
11	PF16656 Pur_ac_phosph_N	2e-20	84.5	Purple acid Phosphatase, N-terminal domain
12	PF14292 SusE	6.9e+02	12.0	SusE outer membrane protein
13	PF07686 V-set	1.8e-15	68.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319623

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000422338	0.682	Protein FAM173B
2	9606.ENSP00000269503	0.530	Cerebellin-2
3	9606.ENSP00000064571	0.520	Cerebellin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0060089	0.578	molecular transducer activity
GO:0038023	0.566	signaling receptor activity
GO:0003824	0.475	catalytic activity
GO:0140096	0.415	catalytic activity, acting on a protein
GO:0042802	0.404	identical protein binding
GO:0004888	0.344	transmembrane signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0050789	0.980	regulation of biological process
GO:0050794	0.967	regulation of cellular process
GO:0032501	0.674	multicellular organismal process
GO:0032502	0.644	developmental process
GO:0048856	0.625	anatomical structure development
GO:0050896	0.553	response to stimulus
GO:0007275	0.422	multicellular organism development
GO:0048731	0.389	system development
GO:0048519	0.332	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.995	membrane
GO:0071944	0.993	cell periphery
GO:0005886	0.981	plasma membrane
GO:0005576	0.744	extracellular region
GO:0005737	0.643	cytoplasm
GO:0043226	0.463	organelle
GO:0120025	0.412	plasma membrane bounded cell projection
GO:0043005	0.380	neuron projection
GO:0005615	0.374	extracellular space
GO:0030424	0.369	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]