StarFunc result for job id Q8TE56

User Input

>input (1095 residues)
MCDGALLPPLVLPVLLLLVWGLDPGTAVGDAAADVEVVLPWRVRPDDVHLPPLPAAPGPR
RRRRPRTPPAAPRARPGERALLLHLPAFGRDLYLQLRRDLRFLSRGFEVEEAGAARRRGR
PAELCFYSGRVLGHPGSLVSLSACGAAGGLVGLIQLGQEQVLIQPLNNSQGPFSGREHLI
RRKWSLTPSPSAEAQRPEQLCKVLTEKKKPTWGRPSRDWRERRNAIRLTSEHTVETLVVA
DADMVQYHGAEAAQRFILTVMNMVYNMFQHQSLGIKINIQVTKLVLLRQRPAKLSIGHHG
ERSLESFCHWQNEEYGGARYLGNNQVPGGKDDPPLVDAAVFVTRTDFCVHKDEPCDTVGI
AYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHNLGMNHDDDHSSCAGRSHIMSGEWVKG
RNPSDLSWSSCSRDDLENFLKSKVSTCLLVTDPRSQHTVRLPHKLPGMHYSANEQCQILF
GMNATFCRNMEHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPE
HVDGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKG
LPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVADRVLDGTPCGP
YETDLCVHGKCQKIGCDGIIGSAAKEDRCGVCSGDGKTCHLVKGDFSHARGTALKDSGKG
SINSDWKIELPGEFQIAGTTVRYVRRGLWEKISAKGPTKLPLHLMVLLFHDQDYGIHYEY
TVPVNRTAENQSEPEKPQDSLFIWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVND
SDCPQASRPEPQVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVAT
RPLYCPGPRPAAVQSCEGQDCLSIWEASEWSQCSASCGKGVWKRTVACTNSQGKCDASTR
PRAEEACEDYSGCYEWKTGDWSTCSSTCGKGLQSRVVQCMHKVTGRHGSECPALSKPAPY
RQCYQEVCNDRINANTITSPRLAALTYKCTRDQWTVYCRVIREKNLCQDMRWYQRCCQTC
RDFYANKMRQPPPNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YX90	0.443	0.443	0.000	1095	0.897	0.897	D3YX90.pdb.gz	D3YX90_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17 OS=Mus musculus OX=10090 GN=Adamts17 PE=1 SV=1
2	AFDB:Q8TE60	0.415	0.380	8.728E-93	1221	0.333	0.299	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
3	AFDB:E7FEJ5	0.407	0.367	1.509E-92	1244	0.328	0.289	E7FEJ5.pdb.gz	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
4	AFDB:Q4VC17	0.385	0.354	1.984E-92	1219	0.332	0.299	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
5	AFDB:Q9H324	0.374	0.372	4.488E-90	1103	0.331	0.328	Q9H324.pdb.gz	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
6	AFDB:Q69Z28	0.412	0.377	1.342E-89	1222	0.321	0.288	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
7	AFDB:D3Z1A5	0.345	0.340	1.765E-89	1117	0.327	0.321	D3Z1A5.pdb.gz	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
8	AFDB:E7FFX0	0.408	0.373	4.477E-89	1224	0.325	0.291	E7FFX0.pdb.gz	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
9	AFDB:Q68SA9	0.389	0.281	3.019E-85	1657	0.318	0.210	Q68SA9.pdb.gz	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
10	AFDB:Q811B3	0.397	0.292	4.904E-82	1600	0.312	0.214	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
11	PDB:4q1lA	0.166	0.832	3.251E-13	202	0.052	0.282	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:1w0rA	0.071	0.138	7.747E-10	442	0.083	0.206	1w0rA.pdb.gz
13	PDB:2x7mA	0.125	0.640	1.400E-5	180	0.026	0.161	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
14	PDB:7nycC	0.046	0.062	7.646E-5	809	0.076	0.103	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
15	PDB:4a5wB	0.053	0.062	1.252E-4	871	0.026	0.033	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
16	PDB:3t5oA	0.051	0.060	3.742E-4	871	0.031	0.039	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:7nydE	0.058	0.115	6.126E-4	484	0.060	0.136	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:4e0sB	0.050	0.057	1.831E-3	898	0.029	0.036	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
19	PDB:4lnvA	0.054	0.049	2.280E-3	1276	0.044	0.038	4lnvA.pdb.gz
20	PDB:4nehA	0.069	0.069	1.467E-2	1084	0.088	0.089	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YX90	0.0	2004	1095	0.883	0.883	D3YX90_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17 OS=Mus musculus OX=10090 GN=Adamts17 PE=1 SV=1
2	D3Z1A5	6.01e-177	550	1117	0.343	0.337	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
3	Q9UKP5	2.28e-175	546	1117	0.342	0.336	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
4	Q9UKP4	7.27e-170	545	1686	0.319	0.207	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
5	Q68SA9	2.39e-164	530	1657	0.313	0.207	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
6	Q8TE60	1.00e-162	515	1221	0.323	0.290	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
7	Q4VC17	4.95e-161	511	1219	0.330	0.296	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
8	D3ZLL7	6.64e-160	508	1221	0.329	0.295	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
9	Q9H324	2.11e-158	501	1103	0.329	0.326	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
10	E7FEJ5	4.96e-156	498	1244	0.312	0.275	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
11	P58397	1.87e-154	501	1594	0.298	0.205	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
12	Q69Z28	2.71e-154	493	1222	0.314	0.282	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
13	Q811B3	9.66e-153	497	1600	0.289	0.198	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
14	E7FFX0	4.18e-134	439	1224	0.324	0.290	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
15	P59511	1.33e-129	437	1906	0.319	0.183	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
16	E9PUN6	1.56e-127	431	1931	0.309	0.175	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
17	P79331	1.72e-127	421	1205	0.286	0.260	ATS2_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Bos taurus OX=9913 GN=ADAMTS2 PE=1 SV=1
18	P59510	2.31e-127	431	1910	0.303	0.174	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
19	O95450	8.29e-127	419	1211	0.284	0.257	ATS2_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Homo sapiens OX=9606 GN=ADAMTS2 PE=2 SV=2
20	Q8C9W3	3.05e-126	417	1213	0.279	0.251	ATS2_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Mus musculus OX=10090 GN=Adamts2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	5.7e-18	76.5	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	0.00015	33.1	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	8.7e-07	40.6	ADAM-TS Spacer 1
4	PF16313 DUF4953	1.8e+02	12.7	Met-zincin
5	PF00413 Peptidase_M10	4.7	18.5	Matrixin
6	PF10462 Peptidase_M66	5.5e+02	10.9	Peptidase M66
7	PF01562 Pep_M12B_propep	1.7e-15	68.9	Reprolysin family propeptide
8	PF08686 PLAC	21	17.3	PLAC (protease and lacunin) domain
9	PF01421 Reprolysin	1.4e-16	72.6	Reprolysin (M12B) family zinc metalloprotease
10	PF13574 Reprolysin_2	0.00039	31.9	Metallo-peptidase family M12B Reprolysin-like
11	PF13582 Reprolysin_3	6.3e-07	41.3	Metallo-peptidase family M12B Reprolysin-like
12	PF13583 Reprolysin_4	0.015	26.5	Metallo-peptidase family M12B Reprolysin-like
13	PF13688 Reprolysin_5	1.4e-09	49.9	Metallo-peptidase family M12
14	PF19030 TSP1_ADAMTS	2e-38	141.8	Thrombospondin type 1 domain
15	PF19035 TSP1_CCN	0.0096	27.6	CCN3 Nov like TSP1 domain
16	PF19028 TSP1_spondin	1.6e-09	49.3	Spondin-like TSP1 domain
17	PF00090 TSP_1	1.2e-21	87.9	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339613	0.953	GDP-fucose protein O-fucosyltransferase 2
2	9606.ENSP00000343002	0.953	Beta-1,3-glucosyltransferase
3	9606.ENSP00000358035	0.935	ADAMTS-like protein 4
4	9606.ENSP00000260356	0.933	Thrombospondin-1
5	9606.ENSP00000346478	0.932	ADAMTS-like protein 2
6	9606.ENSP00000483599	0.932	Spondin-2
7	9606.ENSP00000369921	0.924	ADAMTS-like protein 1
8	9606.ENSP00000286744	0.923	ADAMTS-like protein 3
9	9606.ENSP00000347484	0.922	Thrombospondin type-1 domain-containing protein 4
10	9606.ENSP00000251582	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 2
11	9606.ENSP00000360997	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 13
12	9606.ENSP00000270328	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 10
13	9606.ENSP00000362304	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 14
14	9606.ENSP00000418735	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 9
15	9606.ENSP00000327608	0.917	ADAMTS-like protein 5
16	9606.ENSP00000374071	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 20
17	9606.ENSP00000274181	0.916	ADAM metallopeptidase with thrombospondin type 1 motif 16
18	9606.ENSP00000284984	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 1
19	9606.ENSP00000356975	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 4
20	9606.ENSP00000299164	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008233	1.000	peptidase activity
GO:0005515	0.996	protein binding
GO:0008237	0.993	metallopeptidase activity
GO:0004175	0.942	endopeptidase activity
GO:0004222	0.845	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.972	cellular process
GO:0071704	0.880	organic substance metabolic process
GO:0043062	0.871	extracellular structure organization
GO:0044238	0.852	primary metabolic process
GO:0045229	0.840	external encapsulating structure organization
GO:0097435	0.824	supramolecular fiber organization
GO:0043170	0.796	macromolecule metabolic process
GO:1901564	0.785	organonitrogen compound metabolic process
GO:0019538	0.743	protein metabolic process
GO:0050789	0.639	regulation of biological process
GO:0050794	0.555	regulation of cellular process
GO:0030198	0.459	extracellular matrix organization
GO:0048519	0.358	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	0.998	extracellular matrix
GO:0043226	0.957	organelle
GO:0005576	0.912	extracellular region
GO:0005622	0.911	intracellular anatomical structure
GO:0043229	0.865	intracellular organelle
GO:0062023	0.831	collagen-containing extracellular matrix
GO:0043227	0.818	membrane-bounded organelle
GO:0043231	0.755	intracellular membrane-bounded organelle
GO:0070013	0.552	intracellular organelle lumen
GO:0005737	0.546	cytoplasm
GO:0012505	0.444	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.845	Metalloendopeptidases.

[back to server]