StarFunc result for job id Q8TE57

User Input

>input (1224 residues)
MKPRARGWRGLAALWMLLAQVAEQAPACAMGPAAAAPGSPSVPRPPPPAERPGWMEKGEY
DLVSAYEVDHRGDYVSHEIMHHQRRRRAVPVSEVESLHLRLKGSRHDFHMDLRTSSSLVA
PGFIVQTLGKTGTKSVQTLPPEDFCFYQGSLRSHRNSSVALSTCQGLSGMIRTEEADYFL
RPLPSHLSWKLGRAAQGSSPSHVLYKRSTEPHAPGASEVLVTSRTWELAHQPLHSSDLRL
GLPQKQHFCGRRKKYMPQPPKEDLFILPDEYKSCLRHKRSLLRSHRNEELNVETLVVVDK
KMMQNHGHENITTYVLTILNMVSALFKDGTIGGNINIAIVGLILLEDEQPGLVISHHADH
TLSSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDTLGFAPISGMCSKYRSCTIN
EDTGLGLAFTIAHESGHNFGMIHDGEGNMCKKSEGNIMSPTLAGRNGVFSWSPCSRQYLH
KFLSTAQAICLADQPKPVKEYKYPEKLPGELYDANTQCKWQFGEKAKLCMLDFKKDICKA
LWCHRIGRKCETKFMPAAEGTICGHDMWCRGGQCVKYGDEGPKPTHGHWSDWSSWSPCSR
TCGGGVSHRSRLCTNPKPSHGGKFCEGSTRTLKLCNSQKCPRDSVDFRAAQCAEHNSRRF
RGRHYKWKPYTQVEDQDLCKLYCIAEGFDFFFSLSNKVKDGTPCSEDSRNVCIDGICERV
GCDNVLGSDAVEDVCGVCNGNNSACTIHRGLYTKHHHTNQYYHMVTIPSGARSIRIYEMN
VSTSYISVRNALRRYYLNGHWTVDWPGRYKFSGTTFDYRRSYNEPENLIATGPTNETLIV
ELLFQGRNPGVAWEYSMPRLGTEKQPPAQPSYTWAIVRSECSVSCGGGQMTVREGCYRDL
KFQVNMSFCNPKTRPVTGLVPCKVSACPPSWSVGNWSACSRTCGGGAQSRPVQCTRRVHY
DSEPVPASLCPQPAPSSRQACNSQSCPPAWSAGPWAECSHTCGKGWRKRAVACKSTNPSA
RAQLLPDAVCTSEPKPRMHEACLLQRCHKPKKLQWLVSAWSQCSVTCERGTQKRFLKCAE
KYVSGKYRELASKKCSHLPKPSLELERACAPLPCPRHPPFAAAGPSRGSWFASPWSQCTA
SCGGGVQTRSVQCLAGGRPASGCLLHQKPSASLACNTHFCPIAEKKDAFCKDYFHWCYLV
PQHGMCSHKFYGKQCCKTCSKSNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z1A5	0.470	0.509	0.000	1117	0.347	0.380	D3Z1A5.pdb.gz	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	AFDB:E7FEJ5	0.590	0.582	0.000	1244	0.566	0.557	E7FEJ5.pdb.gz	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
3	AFDB:E7FFX0	0.591	0.591	0.000	1224	0.597	0.597	E7FFX0.pdb.gz	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
4	AFDB:Q4VC17	0.625	0.627	0.000	1219	0.547	0.549	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
5	AFDB:Q69Z28	0.630	0.631	0.000	1222	0.826	0.827	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
6	AFDB:Q8TE60	0.658	0.659	0.000	1221	0.554	0.555	Q8TE60.pdb.gz	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
7	AFDB:Q9H324	0.470	0.516	0.000	1103	0.333	0.370	Q9H324.pdb.gz	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
8	AFDB:Q9P2N4	0.464	0.310	3.972E-103	1935	0.315	0.199	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
9	AFDB:P58397	0.482	0.382	5.134E-102	1594	0.356	0.274	P58397.pdb.gz	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
10	AFDB:Q811B3	0.489	0.384	8.296E-102	1600	0.361	0.276	Q811B3.pdb.gz	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
11	PDB:4q1lA	0.152	0.858	8.945E-15	202	0.050	0.302	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:1w0rA	0.064	0.118	1.647E-11	442	0.069	0.192	1w0rA.pdb.gz
13	PDB:7ufgA	0.121	0.128	2.973E-6	1151	0.102	0.109	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:2x7mA	0.113	0.628	7.687E-5	180	0.025	0.172	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
15	PDB:7nydE	0.052	0.115	4.969E-4	484	0.063	0.159	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:3t5oA	0.035	0.046	9.938E-4	871	0.023	0.032	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:7nycC	0.045	0.065	1.230E-3	809	0.061	0.093	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:4a5wB	0.046	0.061	3.045E-3	871	0.024	0.033	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
19	PDB:4e0sB	0.034	0.045	3.388E-3	898	0.025	0.033	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
20	PDB:7nycD	0.048	0.107	8.386E-3	487	0.060	0.150	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z1A5	0.0	729	1117	0.337	0.370	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	D3ZLL7	0.0	2071	1221	0.807	0.809	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
3	E7FEJ5	0.0	1438	1244	0.567	0.558	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
4	E7FFX0	0.0	1492	1224	0.600	0.600	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
5	P58397	0.0	609	1594	0.306	0.235	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
6	Q4VC17	0.0	1364	1219	0.544	0.546	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
7	Q69Z28	0.0	2097	1222	0.826	0.827	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
8	Q811B3	0.0	605	1600	0.305	0.233	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
9	Q8TE60	0.0	1409	1221	0.554	0.555	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
10	Q9H324	0.0	649	1103	0.318	0.353	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
11	Q9UKP4	0.0	609	1686	0.300	0.218	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
12	Q9UKP5	0.0	720	1117	0.334	0.366	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
13	Q68SA9	3.29e-175	563	1657	0.260	0.192	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
14	Q9P2N4	1.32e-164	539	1935	0.296	0.187	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
15	E9PUN6	3.29e-163	535	1931	0.291	0.184	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
16	D3YX90	2.35e-159	506	1095	0.284	0.318	D3YX90_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17 OS=Mus musculus OX=10090 GN=Adamts17 PE=1 SV=1
17	P59511	1.54e-155	513	1906	0.287	0.184	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
18	P59510	5.92e-152	503	1910	0.288	0.184	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
19	O15072	6.30e-151	487	1205	0.275	0.280	ATS3_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 3 OS=Homo sapiens OX=9606 GN=ADAMTS3 PE=1 SV=4
20	P79331	2.82e-150	485	1205	0.270	0.275	ATS2_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Bos taurus OX=9913 GN=ADAMTS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	5.7e-15	66.9	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	0.0028	29.1	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	3.2e-27	106.5	ADAM-TS Spacer 1
4	PF01562 Pep_M12B_propep	1.1e-30	118.2	Reprolysin family propeptide
5	PF08686 PLAC	2.1e-08	46.1	PLAC (protease and lacunin) domain
6	PF01421 Reprolysin	5.6e-26	103.3	Reprolysin (M12B) family zinc metalloprotease
7	PF13574 Reprolysin_2	0.0011	30.5	Metallo-peptidase family M12B Reprolysin-like
8	PF13582 Reprolysin_3	8.8e-05	34.4	Metallo-peptidase family M12B Reprolysin-like
9	PF13583 Reprolysin_4	1.8	19.7	Metallo-peptidase family M12B Reprolysin-like
10	PF13688 Reprolysin_5	3.9e-07	41.9	Metallo-peptidase family M12
11	PF19030 TSP1_ADAMTS	1.2e-46	168.1	Thrombospondin type 1 domain
12	PF19035 TSP1_CCN	3.1e-07	41.9	CCN3 Nov like TSP1 domain
13	PF19028 TSP1_spondin	7.9e-12	56.6	Spondin-like TSP1 domain
14	PF00090 TSP_1	1.3e-23	94.2	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274181

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387356	0.936	Aggrecan core protein
2	9606.ENSP00000260356	0.934	Thrombospondin-1
3	9606.ENSP00000274487	0.924	ADAM metallopeptidase with thrombospondin type 1 motif 19
4	9606.ENSP00000286744	0.924	ADAMTS-like protein 3
5	9606.ENSP00000360997	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 13
6	9606.ENSP00000362304	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 14
7	9606.ENSP00000369921	0.920	ADAMTS-like protein 1
8	9606.ENSP00000339613	0.917	GDP-fucose protein O-fucosyltransferase 2
9	9606.ENSP00000268070	0.916	ADAM metallopeptidase with thrombospondin type 1 motif 17
10	9606.ENSP00000284984	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 1
11	9606.ENSP00000346478	0.916	ADAMTS-like protein 2
12	9606.ENSP00000374071	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 20
13	9606.ENSP00000251582	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 2
14	9606.ENSP00000299164	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 15
15	9606.ENSP00000343002	0.915	Beta-1,3-glucosyltransferase
16	9606.ENSP00000356975	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 4
17	9606.ENSP00000418735	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 9
18	9606.ENSP00000355751	0.914	Thrombospondin-2
19	9606.ENSP00000257359	0.913	A disintegrin and metalloproteinase with thrombospondin motifs 8
20	9606.ENSP00000284987	0.913	A disintegrin and metalloproteinase with thrombospondin motifs 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	0.999	metalloendopeptidase activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.955	biological regulation
GO:0050789	0.947	regulation of biological process
GO:0050794	0.940	regulation of cellular process
GO:0009987	0.938	cellular process
GO:0032501	0.884	multicellular organismal process
GO:0048856	0.810	anatomical structure development
GO:0007275	0.796	multicellular organism development
GO:0048519	0.778	negative regulation of biological process
GO:0048523	0.671	negative regulation of cellular process
GO:0051241	0.668	negative regulation of multicellular organismal process
GO:0048731	0.660	system development
GO:0071704	0.627	organic substance metabolic process
GO:0044238	0.622	primary metabolic process
GO:0006807	0.611	nitrogen compound metabolic process
GO:0043170	0.566	macromolecule metabolic process
GO:0048583	0.554	regulation of response to stimulus
GO:0019538	0.549	protein metabolic process
GO:0010543	0.516	regulation of platelet activation
GO:0030155	0.469	regulation of cell adhesion
GO:0032101	0.431	regulation of response to external stimulus
GO:0035295	0.431	tube development
GO:0065008	0.423	regulation of biological quality
GO:0071840	0.404	cellular component organization or biogenesis
GO:0050896	0.360	response to stimulus
GO:0016043	0.345	cellular component organization
GO:0006508	0.332	proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0043227	0.992	membrane-bounded organelle
GO:0005576	0.985	extracellular region
GO:0071944	0.951	cell periphery
GO:0043231	0.937	intracellular membrane-bounded organelle
GO:0012505	0.914	endomembrane system
GO:0031012	0.871	extracellular matrix
GO:0005615	0.748	extracellular space
GO:0005737	0.666	cytoplasm
GO:0005783	0.570	endoplasmic reticulum
GO:0062023	0.511	collagen-containing extracellular matrix
GO:0070013	0.509	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	0.999	Metalloendopeptidases.

[back to server]