StarFunc result for job id Q8TE58

User Input

>input (950 residues)
MLLLGILTLAFAGRTAGGSEPEREVVVPIRLDPDINGRRYYWRGPEDSGDQGLIFQITAF
QEDFYLHLTPDAQFLAPAFSTEHLGVPLQGLTGGSSDLRRCFYSGDVNAEPDSFAAVSLC
GGLRGAFGYRGAEYVISPLPNASAPAAQRNSQGAHLLQRRGVPGGPSGDPTSRCGVASGW
NPAILRALDPYKPRRAGFGESRSRRRSGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLRDRDSGPKVTGNAALTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQDLCGATTCDTLGMADVGTMCDPKRSCSVIEDDGLPSAFTTA
HELGHVFNMPHDNVKVCEEVFGKLRANHMMSPTLIQIDRANPWSACSAAIITDFLDSGHG
DCLLDQPSKPISLPEDLPGASYTLSQQCELAFGVGSKPCPYMQYCTKLWCTGKAKGQMVC
QTRHFPWADGTSCGEGKLCLKGACVERHNLNKHRVDGSWAKWDPYGPCSRTCGGGVQLAR
RQCTNPTPANGGKYCEGVRVKYRSCNLEPCPSSASGKSFREEQCEAFNGYNHSTNRLTLA
VAWVPKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCSPDSTSVCVQGKCIKAGCD
GNLGSKKRFDKCGVCGGDNKSCKKVTGLFTKPMHGYNFVVAIPAGASSIDIRQRGYKGLI
GDDNYLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLT
VEVLSVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQPDDRPP
ARWVAGSWGPCSASCGSGLQKRAVDCRGSAGQRTVPACDAAHRPVETQACGEPCPTWELS
AWSPCSKSCGRGFQRRSLKCVGHGGRLLARDQCNLHRKPQELDFCVLRPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59384	0.663	0.663	0.000	950	0.931	0.931	P59384.pdb.gz	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
2	AFDB:P97857	0.610	0.599	0.000	968	0.483	0.474	P97857.pdb.gz	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
3	AFDB:Q9UHI8	0.615	0.604	0.000	967	0.494	0.485	Q9UHI8.pdb.gz	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
4	AFDB:Q9UP79	0.592	0.631	2.148E-101	889	0.434	0.463	Q9UP79.pdb.gz	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
5	AFDB:F1R6Q4	0.573	0.384	2.262E-101	1461	0.427	0.278	F1R6Q4.pdb.gz
6	AFDB:P59511	0.569	0.294	2.306E-100	1906	0.437	0.218	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
7	AFDB:Q9P2N4	0.556	0.288	1.049E-98	1935	0.423	0.208	Q9P2N4.pdb.gz	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
8	AFDB:P59510	0.557	0.292	1.565E-96	1910	0.403	0.201	P59510.pdb.gz	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
9	AFDB:Q9R001	0.599	0.611	5.985E-96	930	0.402	0.411	Q9R001.pdb.gz	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
10	AFDB:E9PUN6	0.571	0.294	2.410E-95	1931	0.424	0.209	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
11	PDB:4q1lA	0.185	0.816	6.189E-11	202	0.061	0.287	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:1w0rA	0.059	0.115	3.142E-6	442	0.077	0.165	1w0rA.pdb.gz
13	PDB:7ufgA	0.169	0.145	1.725E-5	1151	0.139	0.115	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:2x7mA	0.141	0.612	1.290E-4	180	0.036	0.189	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
15	PDB:7ufgB	0.166	0.138	3.438E-4	1182	0.131	0.105	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	PDB:3afkA	0.078	0.297	3.505E-3	167	0.013	0.072	3afkA.pdb.gz	Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
17	PDB:3t5oA	0.065	0.070	4.536E-3	871	0.025	0.028	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
18	PDB:8a7eC	0.144	0.096	4.536E-3	1524	0.096	0.060	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
19	PDB:4a5wB	0.066	0.071	5.871E-3	871	0.027	0.030	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
20	PDB:2n6fA	0.045	0.186	1.036E-2	136	0.025	0.176	2n6fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PUN6	0.0	702	1931	0.415	0.204	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
2	F1SFS3	0.0	660	2000	0.405	0.193	F1SFS3_PIG ADAM metallopeptidase with thrombospondin type 1 motif 9 OS=Sus scrofa OX=9823 GN=ADAMTS9 PE=4 SV=5
3	G3V673	0.0	675	927	0.381	0.391	G3V673_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=4 SV=1
4	O75173	0.0	681	837	0.382	0.434	ATS4_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Homo sapiens OX=9606 GN=ADAMTS4 PE=1 SV=3
5	P59384	0.0	1820	950	0.931	0.931	ATS15_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 15 OS=Mus musculus OX=10090 GN=Adamts15 PE=1 SV=2
6	P59510	0.0	684	1910	0.389	0.194	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
7	P59511	0.0	720	1906	0.438	0.218	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
8	P97857	0.0	904	968	0.484	0.475	ATS1_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Mus musculus OX=10090 GN=Adamts1 PE=1 SV=4
9	Q6TY19	0.0	678	928	0.381	0.390	Q6TY19_RAT ADAMTS5 OS=Rattus norvegicus OX=10116 GN=Adamts5 PE=2 SV=1
10	Q8BNJ2	0.0	673	833	0.382	0.436	ATS4_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Mus musculus OX=10090 GN=Adamts4 PE=2 SV=2
11	Q9ESP7	0.0	630	630	0.328	0.495	ATS4_RAT A disintegrin and metalloproteinase with thrombospondin motifs 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Adamts4 PE=2 SV=2
12	Q9P2N4	0.0	717	1935	0.419	0.206	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
13	Q9R001	0.0	679	930	0.384	0.392	ATS5_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Mus musculus OX=10090 GN=Adamts5 PE=2 SV=2
14	Q9TT93	0.0	672	839	0.382	0.433	ATS4_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 4 OS=Bos taurus OX=9913 GN=ADAMTS4 PE=1 SV=3
15	Q9UHI8	0.0	909	967	0.487	0.479	ATS1_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Homo sapiens OX=9606 GN=ADAMTS1 PE=1 SV=4
16	Q9UNA0	0.0	674	930	0.394	0.402	ATS5_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 5 OS=Homo sapiens OX=9606 GN=ADAMTS5 PE=1 SV=2
17	Q9UP79	0.0	779	889	0.434	0.463	ATS8_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 8 OS=Homo sapiens OX=9606 GN=ADAMTS8 PE=2 SV=2
18	Q9WUQ1	0.0	908	967	0.496	0.487	ATS1_RAT A disintegrin and metalloproteinase with thrombospondin motifs 1 OS=Rattus norvegicus OX=10116 GN=Adamts1 PE=2 SV=1
19	Q19791	2.28e-174	560	2150	0.339	0.150	GON1_CAEEL A disintegrin and metalloproteinase with thrombospondin motifs gon-1 OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=3
20	H2L2A7	5.95e-171	550	2165	0.339	0.149	H2L2A7_CAEEL Peptidase M12B domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	6.1e-16	70.0	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	2.3e-07	42.2	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	1.3e-25	101.4	ADAM-TS Spacer 1
4	PF01562 Pep_M12B_propep	1.6e-18	78.8	Reprolysin family propeptide
5	PF01421 Reprolysin	1.1e-15	69.7	Reprolysin (M12B) family zinc metalloprotease
6	PF13574 Reprolysin_2	25	16.2	Metallo-peptidase family M12B Reprolysin-like
7	PF13582 Reprolysin_3	9e-05	34.4	Metallo-peptidase family M12B Reprolysin-like
8	PF13688 Reprolysin_5	1.2e-07	43.6	Metallo-peptidase family M12
9	PF19030 TSP1_ADAMTS	1.4e-21	87.8	Thrombospondin type 1 domain
10	PF19035 TSP1_CCN	0.42	22.3	CCN3 Nov like TSP1 domain
11	PF19028 TSP1_spondin	0.0001	33.9	Spondin-like TSP1 domain
12	PF00090 TSP_1	6e-11	53.7	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299164

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258613	0.950	Thrombospondin type-1 domain-containing protein 1
2	9606.ENSP00000346478	0.924	ADAMTS-like protein 2
3	9606.ENSP00000360997	0.924	A disintegrin and metalloproteinase with thrombospondin motifs 13
4	9606.ENSP00000260356	0.922	Thrombospondin-1
5	9606.ENSP00000362304	0.921	A disintegrin and metalloproteinase with thrombospondin motifs 14
6	9606.ENSP00000369921	0.921	ADAMTS-like protein 1
7	9606.ENSP00000373472	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 7
8	9606.ENSP00000422554	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 12
9	9606.ENSP00000274487	0.918	ADAM metallopeptidase with thrombospondin type 1 motif 19
10	9606.ENSP00000286657	0.917	A disintegrin and metalloproteinase with thrombospondin motifs 3
11	9606.ENSP00000251582	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 2
12	9606.ENSP00000268070	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 17
13	9606.ENSP00000274181	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 16
14	9606.ENSP00000282849	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 18
15	9606.ENSP00000286744	0.915	ADAMTS-like protein 3
16	9606.ENSP00000270328	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 10
17	9606.ENSP00000370443	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 6
18	9606.ENSP00000483599	0.914	Spondin-2
19	9606.ENSP00000418735	0.911	A disintegrin and metalloproteinase with thrombospondin motifs 9
20	9606.ENSP00000247153	0.910	Properdin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004175	0.999	endopeptidase activity
GO:0008237	0.997	metallopeptidase activity
GO:0005515	0.995	protein binding
GO:1901681	0.977	sulfur compound binding
GO:0008201	0.963	heparin binding
GO:0050840	0.962	extracellular matrix binding
GO:0004222	0.950	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0045229	0.951	external encapsulating structure organization
GO:0043062	0.942	extracellular structure organization
GO:0022411	0.912	cellular component disassembly
GO:0048856	0.895	anatomical structure development
GO:0030198	0.879	extracellular matrix organization
GO:0022617	0.678	extracellular matrix disassembly
GO:0050789	0.648	regulation of biological process
GO:0071704	0.622	organic substance metabolic process
GO:0006807	0.611	nitrogen compound metabolic process
GO:0044238	0.605	primary metabolic process
GO:0043170	0.548	macromolecule metabolic process
GO:0050794	0.545	regulation of cellular process
GO:1901564	0.537	organonitrogen compound metabolic process
GO:0019538	0.527	protein metabolic process
GO:0006508	0.478	proteolysis
GO:0000768	0.392	syncytium formation by plasma membrane fusion
GO:0061061	0.340	muscle structure development
GO:0032501	0.335	multicellular organismal process
GO:0030154	0.333	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005576	0.994	extracellular region
GO:0071944	0.972	cell periphery
GO:0012505	0.951	endomembrane system
GO:0062023	0.923	collagen-containing extracellular matrix
GO:0043226	0.870	organelle
GO:0005615	0.796	extracellular space
GO:0043227	0.789	membrane-bounded organelle
GO:0005622	0.760	intracellular anatomical structure
GO:0043229	0.743	intracellular organelle
GO:0043231	0.711	intracellular membrane-bounded organelle
GO:0070013	0.524	intracellular organelle lumen
GO:0005737	0.514	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.999	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.950	Metalloendopeptidases.

[back to server]