StarFunc result for job id Q8TE59

User Input

>input (1207 residues)
MRLTHICCCCLLYQLGFLSNGIVSELQFAPDREEWEVVFPALWRREPVDPAGGSGGSADP
GWVRGVGGGGSARAQAAGSSREVRSVAPVPLEEPVEGRSESRLRPPPPSEGEEDEELESQ
ELPRGSSGAAALSPGAPASWQPPPPPQPPPSPPPAQHAEPDGDEVLLRIPAFSRDLYLLL
RRDGRFLAPRFAVEQRPNPGPGPTGAASAPQPPAPPDAGCFYTGAVLRHPGSLASFSTCG
GGLMGFIQLNEDFIFIEPLNDTMAITGHPHRVYRQKRSMEEKVTEKSALHSHYCGIISDK
GRPRSRKIAESGRGKRYSYKLPQEYNIETVVVADPAMVSYHGADAARRFILTILNMVFNL
FQHKSLSVQVNLRVIKLILLHETPPELYIGHHGEKMLESFCKWQHEEFGKKNDIHLEMST
NWGEDMTSVDAAILITRKDFCVHKDEPCDTVGIAYLSGMCSEKRKCIIAEDNGLNLAFTI
AHEMGHNMGINHDNDHPSCADGLHIMSGEWIKGQNLGDVSWSRCSKEDLERFLRSKASNC
LLQTNPQSVNSVMVPSKLPGMTYTADEQCQILFGPLASFCQEMQHVICTGLWCKVEGEKE
CRTKLDPPMDGTDCDLGKWCKAGECTSRTSAPEHLAGEWSLWSPCSRTCSAGISSRERKC
PGLDSEARDCNGPRKQYRICENPPCPAGLPGFRDWQCQAYSVRTSSPKHILQWQAVLDEE
KPCALFCSPVGKEQPILLSEKVMDGTSCGYQGLDICANGRCQKVGCDGLLGSLAREDHCG
VCNGNGKSCKIIKGDFNHTRGAGYVEVLVIPAGARRIKVVEEKPAHSYLALRDAGKQSIN
SDWKIEHSGAFNLAGTTVHYVRRGLWEKISAKGPTTAPLHLLVLLFQDQNYGLHYEYTIP
SDPLPENQSSKAPEPLFMWTHTSWEDCDATCGGGERKTTVSCTKIMSKNISIVDNEKCKY
LTKPEPQIRKCNEQPCQTRWMMTEWTPCSRTCGKGMQSRQVACTQQLSNGTLIRARERDC
IGPKPASAQRCEGQDCMTVWEAGVWSECSVKCGKGIRHRTVRCTNPRKKCVLSTRPREAE
DCEDYSKCYVWRMGDWSKCSITCGKGMQSRVIQCMHKITGRHGNECFSSEKPAAYRPCHL
QPCNEKINVNTITSPRLAALTFKCLGDQWPVYCRVIREKNLCQDMRWYQRCCETCRDFYA
QKLQQKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58397	0.238	0.184	1.321E-77	1594	0.287	0.218	P58397.pdb.gz	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
2	AFDB:P82987	0.203	0.149	5.734E-46	1691	0.152	0.108	P82987.pdb.gz	ATL3_HUMAN ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4
3	AFDB:Q8N6G6	0.197	0.139	8.876E-46	1762	0.152	0.104	Q8N6G6.pdb.gz	ATL1_HUMAN ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4
4	PDB:4q1lA	0.153	0.857	1.837E-12	202	0.051	0.307	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
5	PDB:1w0rA	0.057	0.124	4.056E-9	442	0.060	0.163	1w0rA.pdb.gz
6	PDB:2x7mA	0.115	0.606	1.633E-5	180	0.030	0.200	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
7	PDB:4a5wB	0.058	0.075	6.002E-4	871	0.018	0.025	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
8	PDB:3t5oA	0.040	0.051	2.351E-3	871	0.039	0.054	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
9	PDB:4zkqA	0.028	0.067	5.050E-3	388	0.031	0.098	4zkqA.pdb.gz
10	PDB:4e0sB	0.048	0.060	5.333E-3	898	0.026	0.035	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
11	AFDB:Q9TXR6	0.065	0.070	6.722E-3	1094	0.086	0.095	Q9TXR6.pdb.gz	Q9TXR6_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=2
12	PDB:4nehA	0.071	0.076	1.425E-2	1084	0.070	0.078	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
13	PDB:1su3B	0.070	0.182	1.505E-2	416	0.039	0.113	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
14	PDB:2n6fA	0.034	0.172	1.978E-2	136	0.012	0.110	2n6fA.pdb.gz
15	AFDB:B7YZW3	0.057	0.037	4.545E-2	2064	0.091	0.053	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
16	AFDB:P47136	0.039	0.036	1.150E-1	1447	0.096	0.080	P47136.pdb.gz	BUD4_YEAST Bud site selection protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD4 PE=1 SV=2
17	AFDB:P08640	0.047	0.043	1.686E-1	1367	0.105	0.093	P08640.pdb.gz	FLO11_YEAST Flocculation protein FLO11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FLO11 PE=1 SV=2
18	AFDB:Q3V1M1	0.042	0.023	1.686E-1	2594	0.103	0.048	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
19	AFDB:Q54NE5	0.036	0.028	2.339E-1	1918	0.089	0.056	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
20	AFDB:Q86UW6	0.039	0.030	3.824E-1	1770	0.057	0.039	Q86UW6.pdb.gz	N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens OX=9606 GN=N4BP2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YX90	0.0	1243	1095	0.494	0.544	D3YX90_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17 OS=Mus musculus OX=10090 GN=Adamts17 PE=1 SV=1
2	D3Z1A5	0.0	577	1117	0.310	0.335	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
3	Q9UKP5	0.0	565	1117	0.307	0.331	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
4	Q9UKP4	1.40e-175	564	1686	0.289	0.207	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
5	Q68SA9	4.69e-173	556	1657	0.269	0.196	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
6	Q69Z28	1.46e-170	539	1222	0.307	0.303	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
7	P58397	2.52e-169	545	1594	0.295	0.223	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
8	D3ZLL7	1.51e-168	534	1221	0.304	0.301	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
9	Q811B3	7.68e-168	541	1600	0.294	0.222	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
10	E7FEJ5	4.54e-163	520	1244	0.295	0.286	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
11	Q8TE60	9.94e-160	511	1221	0.284	0.281	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
12	Q4VC17	1.35e-155	499	1219	0.286	0.283	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
13	E7FFX0	3.27e-148	480	1224	0.283	0.279	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
14	Q9H324	2.99e-144	466	1103	0.294	0.322	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
15	Q8C9W3	2.40e-130	431	1213	0.246	0.245	ATS2_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Mus musculus OX=10090 GN=Adamts2 PE=1 SV=2
16	P79331	7.28e-130	430	1205	0.247	0.247	ATS2_BOVIN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Bos taurus OX=9913 GN=ADAMTS2 PE=1 SV=1
17	O95450	2.88e-129	428	1211	0.250	0.249	ATS2_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 2 OS=Homo sapiens OX=9606 GN=ADAMTS2 PE=2 SV=2
18	P59510	8.59e-128	435	1910	0.262	0.165	ATS20_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Homo sapiens OX=9606 GN=ADAMTS20 PE=2 SV=2
19	P59511	1.94e-127	434	1906	0.273	0.173	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
20	G3X9D2	1.66e-126	421	1203	0.244	0.244	G3X9D2_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	1e-14	66.0	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	1.1	20.7	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	1.6e-23	94.6	ADAM-TS Spacer 1
4	PF00413 Peptidase_M10	3.1	19.1	Matrixin
5	PF01562 Pep_M12B_propep	9.8e-15	66.5	Reprolysin family propeptide
6	PF08686 PLAC	2.9	20.0	PLAC (protease and lacunin) domain
7	PF01421 Reprolysin	1.2e-16	72.8	Reprolysin (M12B) family zinc metalloprotease
8	PF13574 Reprolysin_2	0.015	26.7	Metallo-peptidase family M12B Reprolysin-like
9	PF13582 Reprolysin_3	9.5e-07	40.7	Metallo-peptidase family M12B Reprolysin-like
10	PF13583 Reprolysin_4	0.18	22.9	Metallo-peptidase family M12B Reprolysin-like
11	PF13688 Reprolysin_5	7.6e-10	50.8	Metallo-peptidase family M12
12	PF19030 TSP1_ADAMTS	4.2e-38	140.7	Thrombospondin type 1 domain
13	PF19035 TSP1_CCN	1.8e-07	42.7	CCN3 Nov like TSP1 domain
14	PF19028 TSP1_spondin	1.5e-06	39.7	Spondin-like TSP1 domain
15	PF00090 TSP_1	1.1e-23	94.4	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274487

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260356	0.932	Thrombospondin-1
2	9606.ENSP00000343002	0.931	Beta-1,3-glucosyltransferase
3	9606.ENSP00000374071	0.928	A disintegrin and metalloproteinase with thrombospondin motifs 20
4	9606.ENSP00000282849	0.926	ADAM metallopeptidase with thrombospondin type 1 motif 18
5	9606.ENSP00000418735	0.925	A disintegrin and metalloproteinase with thrombospondin motifs 9
6	9606.ENSP00000274181	0.924	ADAM metallopeptidase with thrombospondin type 1 motif 16
7	9606.ENSP00000369921	0.922	ADAMTS-like protein 1
8	9606.ENSP00000360997	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 13
9	9606.ENSP00000422554	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 12
10	9606.ENSP00000257359	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 8
11	9606.ENSP00000373472	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 7
12	9606.ENSP00000284984	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 1
13	9606.ENSP00000299164	0.918	ADAM metallopeptidase with thrombospondin type 1 motif 15
14	9606.ENSP00000346478	0.918	ADAMTS-like protein 2
15	9606.ENSP00000362304	0.918	A disintegrin and metalloproteinase with thrombospondin motifs 14
16	9606.ENSP00000286744	0.917	ADAMTS-like protein 3
17	9606.ENSP00000347484	0.916	Thrombospondin type-1 domain-containing protein 4
18	9606.ENSP00000270328	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 10
19	9606.ENSP00000356975	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 4
20	9606.ENSP00000251582	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008237	0.999	metallopeptidase activity
GO:0004175	0.987	endopeptidase activity
GO:0004222	0.969	metalloendopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0043062	0.911	extracellular structure organization
GO:0045229	0.882	external encapsulating structure organization
GO:0030198	0.839	extracellular matrix organization
GO:0050789	0.693	regulation of biological process
GO:0044238	0.635	primary metabolic process
GO:0071704	0.630	organic substance metabolic process
GO:0006807	0.602	nitrogen compound metabolic process
GO:0043170	0.572	macromolecule metabolic process
GO:0050794	0.562	regulation of cellular process
GO:1901564	0.560	organonitrogen compound metabolic process
GO:0019538	0.550	protein metabolic process
GO:0048519	0.521	negative regulation of biological process
GO:0032502	0.485	developmental process
GO:0048856	0.471	anatomical structure development
GO:0032501	0.419	multicellular organismal process
GO:0097435	0.352	supramolecular fiber organization
GO:0006508	0.323	proteolysis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.995	collagen-containing extracellular matrix
GO:0043226	0.811	organelle
GO:0043227	0.746	membrane-bounded organelle
GO:0043229	0.700	intracellular organelle
GO:0043231	0.680	intracellular membrane-bounded organelle
GO:0005737	0.395	cytoplasm
GO:0016020	0.339	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.24.-	0.969	Metalloendopeptidases.

[back to server]