StarFunc result for job id Q8TE60

User Input

>input (1221 residues)
MECALLLACAFPAAGSGPPRGLAGLGRVAKALQLCCLCCASVAAALASDSSSGASGLNDD
YVFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSS
HFIVQVLGKDGASETQKPEVQQCFYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISP
LPQLLAQEHNYSSPAGHHPHVLYKRTAEEKIQRYRGYPGSGRNYPGYSPSHIPHASQSRE
TEYHHRRLQKQHFCGRRKKYAPKPPTEDTYLRFDEYGSSGRPRRSAGKSQKGLNVETLVV
ADKKMVEKHGKGNVTTYILTVMNMVSGLFKDGTIGSDINVVVVSLILLEQEPGGLLINHH
ADQSLNSFCQWQSALIGKNGKRHDHAILLTGFDICSWKNEPCDTLGFAPISGMCSKYRSC
TINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKAEGNIMSPTLTGNNGVFSWSSCSRQ
YLKKFLSTPQAGCLVDEPKQAGQYKYPDKLPGQIYDADTQCKWQFGAKAKLCSLGFVKDI
CKSLWCHRVGHRCETKFMPAAEGTVCGLSMWCRQGQCVKFGELGPRPIHGQWSAWSKWSE
CSRTCGGGVKFQERHCNNPKPQYGGLFCPGSSRIYQLCNINPCNENSLDFRAQQCAEYNS
KPFRGWFYQWKPYTKVEEEDRCKLYCKAENFEFFFAMSGKVKDGTPCSPNKNDVCIDGVC
ELVGCDHELGSKAVSDACGVCKGDNSTCKFYKGLYLNQHKANEYYPVVLIPAGARSIEIQ
ELQVSSSYLAVRSLSQKYYLTGGWSIDWPGEFPFAGTTFEYQRSFNRPERLYAPGPTNET
LVFEILMQGKNPGIAWKYALPKVMNGTPPATKRPAYTWSIVQSECSVSCGGGYINVKAIC
LRDQNTQVNSSFCSAKTKPVTEPKICNAFSCPAYWMPGEWSTCSKACAGGQQSRKIQCVQ
KKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPQWSLGPWSQCSKTCGRGVRKRELLCKG
SAAETLPESQCTSLPRPELQEGCVLGRCPKNSRLQWVASSWSECSATCGLGVRKREMKCS
EKGFQGKLITFPERRCRNIKKPNLDLEETCNRRACPAHPVYNMVAGWYSLPWQQCTVTCG
GGVQTRSVHCVQQGRPSSSCLLHQKPPVLRACNTNFCPAPEKREDPSCVDFFNWCHLVPQ
HGVCNHKFYGKQCCKSCTRKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z1A5	0.495	0.536	0.000	1117	0.351	0.383	D3Z1A5.pdb.gz	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	AFDB:E7FEJ5	0.721	0.709	0.000	1244	0.654	0.641	E7FEJ5.pdb.gz	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
3	AFDB:E7FFX0	0.648	0.646	0.000	1224	0.543	0.542	E7FFX0.pdb.gz	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
4	AFDB:E9PUN6	0.445	0.295	0.000	1931	0.323	0.204	E9PUN6.pdb.gz	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
5	AFDB:F1R6Q4	0.469	0.397	0.000	1461	0.313	0.261	F1R6Q4.pdb.gz
6	AFDB:P58397	0.474	0.370	0.000	1594	0.342	0.262	P58397.pdb.gz	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
7	AFDB:P59511	0.440	0.294	0.000	1906	0.309	0.198	P59511.pdb.gz	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
8	AFDB:Q4VC17	0.720	0.721	0.000	1219	0.880	0.882	Q4VC17.pdb.gz	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
9	AFDB:Q68SA9	0.472	0.359	0.000	1657	0.337	0.249	Q68SA9.pdb.gz	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
10	AFDB:Q69Z28	0.706	0.706	0.000	1222	0.548	0.547	Q69Z28.pdb.gz	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
11	PDB:4q1lA	0.152	0.860	1.401E-14	202	0.049	0.297	4q1lA.pdb.gz	Complete amino-acid sequence, crystallization and preliminary X-ray diffraction studies of leucurolysin-a, a nonhaemorrhagic metalloproteinase from Bothrops leucurus snake venom.
12	PDB:1w0rA	0.069	0.135	6.660E-10	442	0.066	0.181	1w0rA.pdb.gz
13	PDB:7ufgA	0.123	0.129	3.054E-6	1151	0.098	0.104	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
14	PDB:2x7mA	0.106	0.574	1.533E-4	180	0.025	0.172	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
15	PDB:3t5oA	0.035	0.047	1.619E-4	871	0.022	0.031	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
16	PDB:4e0sB	0.047	0.062	3.865E-4	898	0.028	0.038	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
17	PDB:4a5wB	0.039	0.052	5.073E-4	871	0.021	0.030	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
18	PDB:7nycC	0.040	0.059	5.972E-4	809	0.043	0.064	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:2n6fA	0.042	0.205	8.276E-4	136	0.016	0.140	2n6fA.pdb.gz
20	PDB:7nydE	0.053	0.118	1.279E-3	484	0.062	0.157	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z1A5	0.0	780	1117	0.342	0.374	D3Z1A5_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 6 OS=Mus musculus OX=10090 GN=Adamts6 PE=4 SV=1
2	D3ZLL7	0.0	1397	1221	0.546	0.546	D3ZLL7_RAT ADAM metallopeptidase with thrombospondin type 1 motif, 16 OS=Rattus norvegicus OX=10116 GN=Adamts16 PE=4 SV=3
3	E7FEJ5	0.0	1660	1244	0.658	0.645	E7FEJ5_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 18 isoform X1 OS=Danio rerio OX=7955 GN=adamts18 PE=4 SV=1
4	E7FFX0	0.0	1346	1224	0.538	0.537	E7FFX0_DANRE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Danio rerio OX=7955 GN=LOC568792 PE=4 SV=3
5	P58397	0.0	620	1594	0.305	0.233	ATS12_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Homo sapiens OX=9606 GN=ADAMTS12 PE=1 SV=2
6	Q4VC17	0.0	2204	1219	0.885	0.886	ATS18_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Mus musculus OX=10090 GN=Adamts18 PE=2 SV=2
7	Q68SA9	0.0	597	1657	0.295	0.217	ATS7_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Mus musculus OX=10090 GN=Adamts7 PE=1 SV=3
8	Q69Z28	0.0	1391	1222	0.545	0.545	ATS16_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 16 OS=Mus musculus OX=10090 GN=Adamts16 PE=2 SV=2
9	Q811B3	0.0	636	1600	0.310	0.237	ATS12_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 12 OS=Mus musculus OX=10090 GN=Adamts12 PE=2 SV=2
10	Q8TE60	0.0	2537	1221	1.000	1.000	ATS18_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 18 OS=Homo sapiens OX=9606 GN=ADAMTS18 PE=1 SV=3
11	Q9H324	0.0	674	1103	0.322	0.356	ATS10_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2
12	Q9UKP4	0.0	622	1686	0.296	0.215	ATS7_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 7 OS=Homo sapiens OX=9606 GN=ADAMTS7 PE=1 SV=2
13	Q9UKP5	0.0	776	1117	0.342	0.374	ATS6_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 6 OS=Homo sapiens OX=9606 GN=ADAMTS6 PE=2 SV=2
14	Q9P2N4	5.38e-174	565	1935	0.309	0.195	ATS9_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 9 OS=Homo sapiens OX=9606 GN=ADAMTS9 PE=1 SV=4
15	E9PUN6	1.86e-168	549	1931	0.304	0.192	E9PUN6_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 9 OS=Mus musculus OX=10090 GN=Adamts9 PE=1 SV=1
16	P59511	3.98e-167	545	1906	0.305	0.195	ATS20_MOUSE A disintegrin and metalloproteinase with thrombospondin motifs 20 OS=Mus musculus OX=10090 GN=Adamts20 PE=2 SV=2
17	O15072	2.02e-163	520	1205	0.281	0.285	ATS3_HUMAN A disintegrin and metalloproteinase with thrombospondin motifs 3 OS=Homo sapiens OX=9606 GN=ADAMTS3 PE=1 SV=4
18	D3YX90	2.64e-163	517	1095	0.291	0.324	D3YX90_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 17 OS=Mus musculus OX=10090 GN=Adamts17 PE=1 SV=1
19	G3X9D2	8.15e-159	508	1203	0.269	0.273	G3X9D2_MOUSE A disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=4 SV=1
20	B2RY57	8.50e-159	508	1203	0.269	0.273	B2RY57_MOUSE A disintegrin-like and metallopeptidase (Reprolysin type) with thrombospondin type 1 motif, 3 OS=Mus musculus OX=10090 GN=Adamts3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17771 ADAMTS_CR_2	1.4e-15	68.8	ADAMTS cysteine-rich domain 2
2	PF19236 ADAMTS_CR_3	1e-07	43.4	ADAMTS cysteine-rich domain
3	PF05986 ADAMTS_spacer1	2.3e-26	103.8	ADAM-TS Spacer 1
4	PF01562 Pep_M12B_propep	3.9e-33	126.1	Reprolysin family propeptide
5	PF08686 PLAC	2.3e-07	42.8	PLAC (protease and lacunin) domain
6	PF01421 Reprolysin	8.7e-25	99.4	Reprolysin (M12B) family zinc metalloprotease
7	PF13574 Reprolysin_2	3.3e-06	38.7	Metallo-peptidase family M12B Reprolysin-like
8	PF13582 Reprolysin_3	0.00028	32.7	Metallo-peptidase family M12B Reprolysin-like
9	PF13583 Reprolysin_4	1.9	19.6	Metallo-peptidase family M12B Reprolysin-like
10	PF13688 Reprolysin_5	2.4e-07	42.6	Metallo-peptidase family M12
11	PF19030 TSP1_ADAMTS	4.7e-51	182.2	Thrombospondin type 1 domain
12	PF19035 TSP1_CCN	0.00043	31.9	CCN3 Nov like TSP1 domain
13	PF19028 TSP1_spondin	1.5e-09	49.3	Spondin-like TSP1 domain
14	PF00090 TSP_1	1.1e-29	113.7	Thrombospondin type 1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343002	0.944	Beta-1,3-glucosyltransferase
2	9606.ENSP00000260356	0.934	Thrombospondin-1
3	9606.ENSP00000387356	0.928	Aggrecan core protein
4	9606.ENSP00000274487	0.926	ADAM metallopeptidase with thrombospondin type 1 motif 19
5	9606.ENSP00000339613	0.925	GDP-fucose protein O-fucosyltransferase 2
6	9606.ENSP00000346478	0.919	ADAMTS-like protein 2
7	9606.ENSP00000360997	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 13
8	9606.ENSP00000369921	0.917	ADAMTS-like protein 1
9	9606.ENSP00000284987	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 5
10	9606.ENSP00000362304	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 14
11	9606.ENSP00000418735	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 9
12	9606.ENSP00000299164	0.915	ADAM metallopeptidase with thrombospondin type 1 motif 15
13	9606.ENSP00000358035	0.915	ADAMTS-like protein 4
14	9606.ENSP00000374071	0.915	A disintegrin and metalloproteinase with thrombospondin motifs 20
15	9606.ENSP00000251582	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 2
16	9606.ENSP00000257359	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 8
17	9606.ENSP00000268070	0.914	ADAM metallopeptidase with thrombospondin type 1 motif 17
18	9606.ENSP00000284984	0.914	A disintegrin and metalloproteinase with thrombospondin motifs 1
19	9606.ENSP00000355751	0.913	Thrombospondin-2
20	9606.ENSP00000356975	0.913	A disintegrin and metalloproteinase with thrombospondin motifs 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	1.000	metalloendopeptidase activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:1903034	0.968	regulation of response to wounding
GO:0050794	0.952	regulation of cellular process
GO:0050878	0.951	regulation of body fluid levels
GO:1900046	0.942	regulation of hemostasis
GO:0050818	0.937	regulation of coagulation
GO:0061041	0.936	regulation of wound healing
GO:0051241	0.909	negative regulation of multicellular organismal process
GO:1900047	0.909	negative regulation of hemostasis
GO:1903035	0.901	negative regulation of response to wounding
GO:0061045	0.882	negative regulation of wound healing
GO:0034110	0.881	regulation of homotypic cell-cell adhesion
GO:0030193	0.857	regulation of blood coagulation
GO:0010543	0.826	regulation of platelet activation
GO:0050819	0.825	negative regulation of coagulation
GO:0030195	0.823	negative regulation of blood coagulation
GO:0009987	0.794	cellular process
GO:0048523	0.733	negative regulation of cellular process
GO:0032501	0.617	multicellular organismal process
GO:0071704	0.611	organic substance metabolic process
GO:0044238	0.611	primary metabolic process
GO:0006807	0.599	nitrogen compound metabolic process
GO:0043170	0.561	macromolecule metabolic process
GO:0007162	0.553	negative regulation of cell adhesion
GO:1901564	0.549	organonitrogen compound metabolic process
GO:0019538	0.541	protein metabolic process
GO:0050866	0.505	negative regulation of cell activation
GO:0032502	0.461	developmental process
GO:0022408	0.458	negative regulation of cell-cell adhesion
GO:0048856	0.426	anatomical structure development
GO:0007275	0.388	multicellular organism development
GO:0071840	0.306	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0012505	0.993	endomembrane system
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005737	0.987	cytoplasm
GO:0005576	0.983	extracellular region
GO:0071944	0.956	cell periphery
GO:0005783	0.923	endoplasmic reticulum
GO:0031974	0.908	membrane-enclosed lumen
GO:0070013	0.881	intracellular organelle lumen
GO:0030312	0.875	external encapsulating structure
GO:0031012	0.866	extracellular matrix
GO:0005615	0.859	extracellular space
GO:0062023	0.646	collagen-containing extracellular matrix
GO:0031982	0.576	vesicle
GO:0005788	0.500	endoplasmic reticulum lumen
GO:0043230	0.347	extracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	1.000	Metalloendopeptidases.

[back to server]