StarFunc result for job id Q8TE68

User Input

>input (723 residues)
MSTATGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASR
KLAVMDSQGRVWAQEMLLRVSPDHVTLLDPASKEELESYPLGAIVRCDAVMPPGRSRSLL
LLVCQEPERAQPDVHFFQGLRLGAELIREDIQGALHNYRSGRGERRAAALRATQEELQRD
RSPAAETPPLQRRPSVRAVISTVERGAGRGRPQAKPIPEAEEAQRPEPVGTSSNADSASP
DLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAEAARVLEHRERGRRSRRRAAG
EGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLFGPLQMIVNTS
GGPEFASSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEF
FSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVAVNGHRDLEPESEPQLESETAG
KWVLCNYDFQARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPGPRL
HHSQSPARSLNSTPPPPPAPAPAPPPALARPRWDRPRWDSCDSLNGLDPSEKEKFSQMLI
VNEELQARLAQGRSGPSRAVPGPRAPEPQLSPGSDASEVRAWLQAKGFSSGTVDALGVLT
GAQLFSLQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKVSELEAVMEKQKKKVEGEVEM
EVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TE68	1.000	1.000	0.000	723	1.000	1.000	Q8TE68.pdb.gz	ES8L1_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1 PE=1 SV=3
2	AFDB:Q99K30	0.494	0.491	3.399E-55	729	0.394	0.391	Q99K30.pdb.gz	ES8L2_MOUSE Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus OX=10090 GN=Eps8l2 PE=1 SV=1
3	AFDB:F1M3L7	0.447	0.396	4.600E-55	822	0.411	0.361	F1M3L7.pdb.gz	EPS8_RAT Epidermal growth factor receptor kinase substrate 8 OS=Rattus norvegicus OX=10116 GN=Eps8 PE=1 SV=2
4	AFDB:A0A3B3ISQ4	0.481	0.445	3.179E-53	788	0.382	0.350	A0A3B3ISQ4.pdb.gz	A0A3B3ISQ4_HUMAN EPS8 like 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=1
5	AFDB:Q8TE67	0.220	0.266	4.614E-40	593	0.275	0.336	Q8TE67.pdb.gz	ES8L3_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2
6	AFDB:G5ED33	0.251	0.200	3.836E-39	917	0.296	0.233	G5ED33.pdb.gz	G5ED33_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant A OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
7	AFDB:Q8IPW1	0.400	0.361	3.775E-34	805	0.253	0.227	Q8IPW1.pdb.gz	Q8IPW1_DROME Arouser, isoform A OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
8	AFDB:G5EFE0	0.238	0.232	5.112E-31	740	0.234	0.228	G5EFE0.pdb.gz	G5EFE0_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant B OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
9	AFDB:E9PCM6	0.084	0.079	3.925E-8	768	0.126	0.118	E9PCM6.pdb.gz	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
10	AFDB:P08630	0.129	0.120	6.834E-8	786	0.097	0.089	P08630.pdb.gz	BTKL_DROME Tyrosine-protein kinase Btk OS=Drosophila melanogaster OX=7227 GN=Btk PE=2 SV=2
11	PDB:3qwyA	0.075	0.316	5.315E-4	170	0.024	0.100	3qwyA.pdb.gz
12	PDB:1k9aB	0.077	0.125	6.502E-4	441	0.021	0.034	1k9aB.pdb.gz
13	PDB:1griA	0.080	0.262	1.191E-3	211	0.029	0.100	1griA.pdb.gz
14	PDB:2h8hA	0.069	0.111	2.807E-3	445	0.021	0.034	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4mk0A	0.106	0.119	2.807E-3	631	0.035	0.040	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:2eyzA	0.085	0.190	2.952E-3	304	0.025	0.059	2eyzA.pdb.gz
17	PDB:3ehqA	0.075	0.285	3.104E-3	182	0.022	0.088	3ehqA.pdb.gz
18	PDB:3pvuA	0.102	0.119	3.995E-3	609	0.030	0.036	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:6x5hA	0.076	0.118	6.614E-3	467	0.014	0.021	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
20	PDB:3uzsA	0.109	0.128	8.511E-3	609	0.030	0.036	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TE68	0.0	1453	723	1.000	1.000	ES8L1_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1 PE=1 SV=3
2	Q99K30	8.65e-147	447	729	0.404	0.401	ES8L2_MOUSE Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Mus musculus OX=10090 GN=Eps8l2 PE=1 SV=1
3	Q9H6S3	5.28e-144	440	715	0.409	0.414	ES8L2_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=2
4	A0A3B3ISQ4	6.70e-139	429	788	0.401	0.368	A0A3B3ISQ4_HUMAN EPS8 like 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=1
5	Q08509	1.23e-109	353	821	0.304	0.268	EPS8_MOUSE Epidermal growth factor receptor kinase substrate 8 OS=Mus musculus OX=10090 GN=Eps8 PE=1 SV=2
6	Q12929	4.20e-107	347	822	0.293	0.258	EPS8_HUMAN Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8 PE=1 SV=1
7	F1M3L7	8.67e-107	346	822	0.297	0.262	EPS8_RAT Epidermal growth factor receptor kinase substrate 8 OS=Rattus norvegicus OX=10116 GN=Eps8 PE=1 SV=2
8	Q8TE67	4.25e-65	228	593	0.248	0.302	ES8L3_HUMAN Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2
9	Q7YTG1	1.08e-41	165	845	0.176	0.150	Q7YTG1_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=2
10	O18250	1.27e-41	165	862	0.176	0.147	O18250_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=3
11	G5EFE0	1.33e-41	164	740	0.174	0.170	G5EFE0_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant B OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
12	G5ED33	2.27e-41	164	917	0.176	0.138	G5ED33_CAEEL Epidermal growth factor receptor pathway substrate 8 splice variant A OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=1
13	Q9U3Z9	2.73e-38	154	778	0.119	0.111	Q9U3Z9_DROME Arouser OS=Drosophila melanogaster OX=7227 GN=aru PE=2 SV=1
14	Q9VPU7	2.73e-38	154	778	0.119	0.111	Q9VPU7_DROME Arouser, isoform C OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
15	Q8IPW1	3.75e-38	154	805	0.119	0.107	Q8IPW1_DROME Arouser, isoform A OS=Drosophila melanogaster OX=7227 GN=aru PE=1 SV=1
16	Q7YTG2	1.66e-32	136	665	0.101	0.110	Q7YTG2_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eps-8 PE=1 SV=2
17	Q8T8Q9	8.58e-11	65.1	251	0.040	0.116	Q8T8Q9_DROME SD03278p OS=Drosophila melanogaster OX=7227 GN=aru PE=2 SV=1
18	E7ERP6	1.02e-07	52.0	83	0.029	0.253	E7ERP6_HUMAN NCK adaptor protein 2 OS=Homo sapiens OX=9606 GN=NCK2 PE=1 SV=1
19	O43639	1.24e-06	53.5	380	0.029	0.055	NCK2_HUMAN Cytoplasmic protein NCK2 OS=Homo sapiens OX=9606 GN=NCK2 PE=1 SV=2
20	Q95PX0	2.24e-06	53.1	397	0.028	0.050	Q95PX0_CAEEL NCK (Non-Catalytic region of tyrosine Kinase) adaptor protein family OS=Caenorhabditis elegans OX=6239 GN=nck-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08416 PTB	2.3e-44	162.1	Phosphotyrosine-binding domain
2	PF18016 SAM_3	1.1e-17	75.0	SAM domain (Sterile alpha motif)
3	PF00018 SH3_1	3.5e-08	44.2	SH3 domain
4	PF17902 SH3_10	3.2e+02	12.8	SH3 domain
5	PF07653 SH3_2	11	17.2	Variant SH3 domain
6	PF08239 SH3_3	0.57	21.9	Bacterial SH3 domain
7	PF06347 SH3_4	8	17.6	Bacterial SH3 domain
8	PF14604 SH3_9	0.027	25.7	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000201647

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354566	0.727	T-cell surface glycoprotein CD3 epsilon chain
2	9606.ENSP00000444201	0.672	Synaptotagmin-7
3	9606.ENSP00000367408	0.646	Peripheral plasma membrane protein CASK
4	9606.ENSP00000365312	0.618	Abl interactor 1
5	9606.ENSP00000475216	0.594	Keratinocyte proline rich protein
6	9606.ENSP00000257527	0.584	Disintegrin and metalloproteinase domain-containing protein 19
7	9606.ENSP00000387784	0.569	Son of sevenless homolog 1
8	9606.ENSP00000341838	0.555	Troponin I, cardiac muscle
9	9606.ENSP00000362255	0.543	Translocator protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.995	cytoskeletal protein binding
GO:0003779	0.992	actin binding
GO:0030695	0.979	GTPase regulator activity
GO:0005085	0.972	guanyl-nucleotide exchange factor activity
GO:0044877	0.961	protein-containing complex binding
GO:0050839	0.910	cell adhesion molecule binding
GO:0045296	0.903	cadherin binding
GO:0005102	0.873	signaling receptor binding
GO:0042608	0.573	T cell receptor binding
GO:0003824	0.406	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048583	0.977	regulation of response to stimulus
GO:0007264	0.965	small GTPase mediated signal transduction
GO:0044089	0.912	positive regulation of cellular component biogenesis
GO:0051130	0.907	positive regulation of cellular component organization
GO:0051056	0.900	regulation of small GTPase mediated signal transduction
GO:0007265	0.900	Ras protein signal transduction
GO:0031346	0.842	positive regulation of cell projection organization
GO:0060491	0.811	regulation of cell projection assembly
GO:0120034	0.789	positive regulation of plasma membrane bounded cell projection assembly
GO:0046578	0.742	regulation of Ras protein signal transduction
GO:0035023	0.708	regulation of Rho protein signal transduction
GO:0007266	0.666	Rho protein signal transduction
GO:0071840	0.332	cellular component organization or biogenesis
GO:0016043	0.303	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.996	plasma membrane
GO:0070062	0.996	extracellular exosome
GO:0120025	0.986	plasma membrane bounded cell projection
GO:0032991	0.979	protein-containing complex
GO:0043229	0.803	intracellular organelle
GO:0031252	0.792	cell leading edge
GO:0031253	0.791	cell projection membrane
GO:0043231	0.785	intracellular membrane-bounded organelle
GO:0001726	0.781	ruffle
GO:0031256	0.770	leading edge membrane
GO:0032587	0.762	ruffle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]