StarFunc result for job id Q8TE69

User Input

>input (158 residues)
MKFGCLSFRQPYAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWEGDAWRELLVER
LGMTPAQIQALLRKGEKFGRGVIAGLVDIGETLQCPEDLTPDEVVELENQAVLTNLKQKY
LTVISNPRWLLEPIPRKGGKDVFQVDIPEHLIPLGHEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TE69	1.000	1.000	3.040E-37	158	1.000	1.000	Q8TE69.pdb.gz	EOLA1_HUMAN Protein EOLA1 OS=Homo sapiens OX=9606 GN=EOLA1 PE=1 SV=3
2	PDB:5y7dA	0.989	0.970	7.547E-36	161	0.987	0.969	5y7dA.pdb.gz
3	AFDB:A0A0R4IR18	0.567	0.176	1.405E-8	564	0.203	0.057	A0A0R4IR18.pdb.gz	A0A0R4IR18_DANRE Activating signal cointegrator 1 OS=Danio rerio OX=7955 GN=dZ221I3.1 PE=1 SV=1
4	AFDB:Q15650	0.554	0.168	3.415E-8	581	0.165	0.045	Q15650.pdb.gz	TRIP4_HUMAN Activating signal cointegrator 1 OS=Homo sapiens OX=9606 GN=TRIP4 PE=1 SV=4
5	AFDB:Q9QXN3	0.548	0.167	8.849E-8	581	0.165	0.045	Q9QXN3.pdb.gz	TRIP4_MOUSE Activating signal cointegrator 1 OS=Mus musculus OX=10090 GN=Trip4 PE=1 SV=2
6	AFDB:G5EDK1	0.563	0.245	1.861E-6	425	0.158	0.059	G5EDK1.pdb.gz	G5EDK1_CAEEL ASC-1 OS=Caenorhabditis elegans OX=6239 GN=trip-4 PE=1 SV=1
7	AFDB:Q9SK61	0.591	0.301	2.724E-6	339	0.196	0.091	Q9SK61.pdb.gz	Q9SK61_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g20410 PE=1 SV=2
8	AFDB:P67603	0.359	0.508	8.470E-2	103	0.127	0.194	P67603.pdb.gz	AC4CH_ECOLI N(4)-acetylcytidine amidohydrolase OS=Escherichia coli (strain K12) OX=83333 GN=yqfB PE=1 SV=1
9	PDB:6h0gB	0.325	0.155	1.065E-1	401	0.120	0.047	6h0gB.pdb.gz	Defining the human C2H2 zinc finger degrome targeted by thalidomide analogs through CRBN.
10	AFDB:Q09769	0.312	0.062	3.211E-1	1067	0.114	0.017	Q09769.pdb.gz	LONM_SCHPO Lon protease homolog, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pim1 PE=3 SV=1
11	AFDB:Q8WTY4	0.154	0.100	6.454E-1	309	0.070	0.036	Q8WTY4.pdb.gz	CPIN1_MOUSE Anamorsin OS=Mus musculus OX=10090 GN=Ciapin1 PE=1 SV=1
12	PDB:1j70A	0.195	0.076	7.617E-1	512	0.063	0.020	1j70A.pdb.gz	Structural and functional analysis of a truncated form of Saccharomyces cerevisiae ATP sulfurylase: C-terminal domain essential for oligomer formation but not for activity.
13	AFDB:H3BV90	0.157	0.116	7.808E-1	246	0.063	0.041	H3BV90.pdb.gz	H3BV90_HUMAN Cytokine induced apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CIAPIN1 PE=1 SV=1
14	PDB:7zelA	0.153	0.055	1.115	827	0.089	0.017	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
15	PDB:3orhA	0.131	0.109	1.266	230	0.101	0.070	3orhA.pdb.gz	The crystal structure of human guanidinoacetate N-methyltransferase with SAH
16	PDB:2eyqA	0.150	0.027	2.103	1146	0.108	0.015	2eyqA.pdb.gz
17	PDB:6pz0A	0.130	0.116	2.103	185	0.095	0.081	6pz0A.pdb.gz	The minimal structure for iodotyrosine deiodinase function is defined by an outlier protein from the thermophilic bacterium Thermotoga neapolitana.
18	PDB:1rf4A	0.148	0.068	2.240	427	0.095	0.035	1rf4A.pdb.gz	Structural studies of Streptococcus pneumoniae EPSP synthase in unliganded state, tetrahedral intermediate-bound state and S3P-GLP-bound state.
19	PDB:3v97A	0.121	0.038	2.544	667	0.082	0.019	3v97A.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
20	PDB:6jv9B	0.140	0.060	2.544	495	0.127	0.040	6jv9B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TE69	1.90e-115	325	158	1.000	1.000	EOLA1_HUMAN Protein EOLA1 OS=Homo sapiens OX=9606 GN=EOLA1 PE=1 SV=3
2	P16086	0.17	34.3	2472	0.234	0.015	SPTN1_RAT Spectrin alpha chain, non-erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Sptan1 PE=1 SV=2
3	P16546	0.17	34.3	2472	0.234	0.015	SPTN1_MOUSE Spectrin alpha chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptan1 PE=1 SV=4
4	A0A0R4IR18	0.18	33.9	564	0.234	0.066	A0A0R4IR18_DANRE Activating signal cointegrator 1 OS=Danio rerio OX=7955 GN=dZ221I3.1 PE=1 SV=1
5	A0A0D9SGF6	0.47	32.7	2498	0.228	0.014	A0A0D9SGF6_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
6	Q13813	0.47	32.7	2472	0.228	0.015	SPTN1_HUMAN Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3
7	A0A0D9SF54	0.48	32.7	2457	0.228	0.015	A0A0D9SF54_HUMAN Spectrin alpha, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=1
8	A0A384P5S9	0.48	32.7	2452	0.228	0.015	A0A384P5S9_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
9	A3FG33	1.1	32.0	2480	0.215	0.014	A3FG33_DANRE Alpha II-spectrin OS=Danio rerio OX=7955 GN=wu:fa20e05 PE=2 SV=1
10	P07751	1.1	32.0	2477	0.196	0.013	SPTN1_CHICK Spectrin alpha chain, non-erythrocytic 1 OS=Gallus gallus OX=9031 GN=SPTAN1 PE=1 SV=3
11	B6A880	1.3	31.6	1487	0.133	0.014	YENB_YERET Toxin subunit YenB OS=Yersinia entomophaga OX=935293 GN=yenB PE=1 SV=1
12	Q9M1S8	1.7	31.2	705	0.114	0.026	GCP2_ARATH Probable glutamate carboxypeptidase AMP1 OS=Arabidopsis thaliana OX=3702 GN=AMP1 PE=1 SV=3
13	Q8DS93	2.2	30.4	250	0.082	0.052	Q8DS93_STRMU Response regulator of the competence regulon, ComE response regulator of sakacin A production OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=comE PE=4 SV=1
14	Q6P4P8	3.9	30.0	852	0.114	0.021	Q6P4P8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=zgc:73085 PE=1 SV=1
15	A1Z9I8	4.5	30.0	5385	0.146	0.004	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	A0A0B4K7P8	4.7	30.0	5394	0.146	0.004	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	A1Z9J0	4.7	30.0	5201	0.146	0.004	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	Q7KJN8	4.7	30.0	5201	0.146	0.004	Q7KJN8_DROME Short stop/Kakapo long isoform OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
19	A1Z9I9	4.8	30.0	5390	0.146	0.004	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	B7YZG2	4.8	30.0	5370	0.146	0.004	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04266 ASCH	3.1	19.8	ASCH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000423099

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000245185	0.769	Metallothionein-2
2	9606.ENSP00000248984	0.636	Uncharacterized protein C22orf24
3	9606.ENSP00000248901	0.598	Cytohesin-4
4	9606.ENSP00000305847	0.556	Sperm acrosome associated 5
5	9606.ENSP00000328992	0.522	PAX3- and PAX7-binding protein 1
6	9606.ENSP00000393163	0.519	Zinc finger protein 630

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0010468	0.974	regulation of gene expression
GO:0032675	0.899	regulation of interleukin-6 production
GO:0009987	0.690	cellular process
GO:0050896	0.416	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005737	0.870	cytoplasm
GO:0043226	0.439	organelle
GO:0043229	0.399	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]