StarFunc result for job id Q8TE73

User Input

>input (1400 residues)
MFRIGRRQLWKHSVTRVLTQRLKGEKEAKRALLDARHNYLFAIVASCLDLNKTEVEDAIL
EGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGND
VALTGVCVFFIRTDPSKAITPDNIHQEVSFNMLDAADGGLLNSVRRLLSDIFIPALRATS
HGWGELEGLQDAANIRQEFLSSLEGFVNVLSGAQESLKEKVNLRKCDILELKTLKEPTDY
LTLANNPETLGKIEDCMKVWIKQTEQVLAENNQLLKEADDVGPRAELEHWKKRLSKFNYL
LEQLKSPDVKAVLAVLAAAKSKLLKTWREMDIRITDATNEAKDNVKYLYTLEKCCDPLYS
SDPLSMMDAIPTLINAIKMIYSISHYYNTSEKITSLFVKVTNQIISACKAYITNNGTASI
WNQPQDVVEEKILSAIKLKQEYQLCFHKTKQKLKQNPNAKQFDFSEMYIFGKFETFHRRL
AKIIDIFTTLKTYSVLQDSTIEGLEDMATKYQGIVATIKKKEYNFLDQRKMDFDQDYEEF
CKQTNDLHNELRKFMDVTFAKIQNTNQALRMLKKFERLNIPNLGIDDKYQLILENYGADI
DMISKLYTKQKYDPPLARNQPPIAGKILWARQLFHRIQQPMQLFQQHPAVLSTAEAKPII
RSYNRMAKVLLEFEVLFHRAWLRQIEEIHVGLEASLLVKAPGTGELFVNFDPQILILFRE
TECMAQMGLEVSPLATSLFQKRDRYKRNFSNMKMMLAEYQRVKSKIPAAIEQLIVPHLAK
VDEALQPGLAALTWTSLNIEAYLENTFAKIKDLELLLDRVNDLIEFRIDAILEEMSSTPL
CQLPQEEPLTCEEFLQMTKDLCVNGAQILHFKSSLVEEAVNELVNMLLDVEVLSEEESEK
ISNENSVNYKNESSAKREEGNFDTLTSSINARANALLLTTVTRKKKETEMLGEEARELLS
HFNHQNMDALLKVTRNTLEAIRKRIHSSHTINFRDSNSASNMKQNSLPIFRASVTLAIPN
IVMAPALEDVQQTLNKAVECIISVPKGVRQWSSELLSKKKIQERKMAALQSNEDSDSDVE
MGENELQDTLEIASVNLPIPVQTKNYYKNVSENKEIVKLVSVLSTIINSTKKEVITSMDC
FKRYNHIWQKGKEEAIKTFITQSPLLSEFESQILYFQNLEQEINAEPEYVCVGSIALYTA
DLKFALTAETKAWMVVIGRHCNKKYRSEMENIFMLIEEFNKKLNRPIKDLDDIRIAMAAL
KEIREEQISIDFQVGPIEESYALLNRYGLLIAREEIDKVDTLHYAWEKLLARAGEVQNKL
VSLQPSFKKELISAVEVFLQDCHQFYLDYDLNGPMASGLKPQEASDRLIMFQNQFDNIYR
KYITYTGGEELFGLPATQYP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7z8fe	0.324	0.109	4.509E-30	4579	0.130	0.040	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
2	PDB:7kzmC	0.342	0.150	1.383E-26	3890	0.214	0.077	7kzmC.pdb.gz	Structure of a microtubule-bound axonemal dynein.
3	AFDB:A0A0R4IUQ6	0.260	0.541	2.019E-19	614	0.083	0.189	A0A0R4IUQ6.pdb.gz
4	AFDB:Q5SX07	0.243	0.662	1.944E-14	457	0.066	0.201	Q5SX07.pdb.gz	Q5SX07_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
5	PDB:7z8jf	0.192	0.347	1.641E-11	674	0.071	0.148	7z8jf.pdb.gz
6	AFDB:Q9VN30	0.202	0.248	9.103E-9	1079	0.059	0.077	Q9VN30.pdb.gz	Q9VN30_DROME Dynein heavy chain linker domain-containing protein OS=Drosophila melanogaster OX=7227 GN=sac PE=4 SV=3
7	AFDB:Q54BR4	0.059	0.051	8.690E-5	1784	0.131	0.103	Q54BR4.pdb.gz	Q54BR4_DICDI Fanconi anemia group I protein homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293476 PE=4 SV=1
8	AFDB:P34561	0.113	0.165	6.600E-4	798	0.094	0.164	P34561.pdb.gz	VPS53_CAEEL Vacuolar protein sorting-associated protein 53 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-53 PE=1 SV=4
9	AFDB:D4A678	0.083	0.057	1.677E-3	2416	0.126	0.073	D4A678.pdb.gz	D4A678_RAT Spectrin, alpha, erythrocytic 1 OS=Rattus norvegicus OX=10116 GN=Spta1 PE=1 SV=4
10	AFDB:E9Q8Q6	0.087	0.083	2.054E-3	1531	0.101	0.093	E9Q8Q6.pdb.gz	CC141_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=2
11	AFDB:A0A087X256	0.071	0.079	2.620E-3	1174	0.106	0.126	A0A087X256.pdb.gz	A0A087X256_HUMAN WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=1
12	PDB:7nfeA	0.069	0.038	3.957E-3	3585	0.125	0.049	7nfeA.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
13	PDB:8a2qB	0.076	0.089	5.474E-3	1084	0.111	0.143	8a2qB.pdb.gz
14	PDB:7useB	0.058	0.070	5.700E-3	1099	0.085	0.108	7useB.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
15	AFDB:O15020	0.099	0.069	6.658E-3	2390	0.116	0.068	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
16	AFDB:Q0HA38	0.054	0.056	7.220E-3	1315	0.103	0.110	Q0HA38.pdb.gz	TT21B_MOUSE Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1
17	PDB:7ktuA	0.054	0.066	1.006E-2	995	0.094	0.133	7ktuA.pdb.gz
18	PDB:7sukSP	0.068	0.053	1.508E-2	2234	0.113	0.071	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
19	PDB:7r5jB0	0.064	0.054	2.356E-2	1748	0.098	0.078	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
20	PDB:3w3uA	0.052	0.062	2.661E-2	1030	0.104	0.142	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4LH20	0.0	705	4724	0.321	0.095	A0A0B4LH20_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Dhc1 PE=3 SV=1
2	Q39575	0.0	693	4485	0.308	0.096	DYHG_CHLRE Dynein gamma chain, flagellar outer arm OS=Chlamydomonas reinhardtii OX=3055 GN=ODA2 PE=1 SV=1
3	Q57WX6	0.0	600	4639	0.299	0.090	Q57WX6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.490 PE=4 SV=1
4	Q8TE73	0.0	2878	4624	1.000	0.303	DYH5_HUMAN Dynein axonemal heavy chain 5 OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3
5	Q8VHE6	0.0	2386	4621	0.824	0.250	DYH5_MOUSE Dynein axonemal heavy chain 5 OS=Mus musculus OX=10090 GN=Dnah5 PE=1 SV=2
6	Q96JB1	0.0	988	4490	0.372	0.116	DYH8_HUMAN Dynein axonemal heavy chain 8 OS=Homo sapiens OX=9606 GN=DNAH8 PE=1 SV=2
7	A8Y5B7	3.25e-161	542	4593	0.270	0.082	A8Y5B7_DROME Male fertility factor kl3 OS=Drosophila melanogaster OX=7227 GN=kl-3 PE=1 SV=3
8	Q9GPN7	6.44e-96	345	4350	0.185	0.060	Q9GPN7_DROME Gamma dynein OS=Drosophila melanogaster OX=7227 GN=kl-3 PE=2 SV=2
9	E7FGT8	5.05e-62	237	4626	0.181	0.055	E7FGT8_DANRE Dynein heavy chain 10, axonemal OS=Danio rerio OX=7955 GN=si:dkeyp-86b9.1 PE=1 SV=2
10	Q9MBF8	3.77e-61	234	4513	0.194	0.060	DYH1B_CHLRE Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1
11	Q580B5	1.12e-53	210	4448	0.165	0.052	Q580B5_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5E12.710 PE=4 SV=1
12	D3YYQ8	7.35e-50	197	4591	0.124	0.038	D3YYQ8_MOUSE Dynein, axonemal, heavy chain 10 OS=Mus musculus OX=10090 GN=Dnah10 PE=1 SV=2
13	Q9SMH3	8.36e-50	197	4625	0.126	0.038	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
14	Q9NYC9	1.40e-41	171	4486	0.121	0.038	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
15	B1AR51	3.47e-39	162	4484	0.103	0.032	B1AR51_MOUSE Dynein, axonemal, heavy chain 9 OS=Mus musculus OX=10090 GN=Dnah9 PE=1 SV=1
16	Q9QZH1	1.33e-37	157	4488	0.100	0.031	Q9QZH1_MOUSE Left-right dynein OS=Mus musculus OX=10090 GN=Dnah11 PE=2 SV=1
17	Q9UFH2	1.73e-37	157	4462	0.106	0.033	DYH17_HUMAN Dynein axonemal heavy chain 17 OS=Homo sapiens OX=9606 GN=DNAH17 PE=1 SV=3
18	E9Q7N9	1.76e-37	157	4488	0.100	0.031	E9Q7N9_MOUSE Dynein, axonemal, heavy chain 11 OS=Mus musculus OX=10090 GN=Dnah11 PE=1 SV=2
19	Q96DT5	2.06e-36	154	4516	0.121	0.037	DYH11_HUMAN Dynein axonemal heavy chain 11 OS=Homo sapiens OX=9606 GN=DNAH11 PE=1 SV=4
20	F1SC07	3.92e-36	152	4518	0.097	0.030	DYH11_PIG Dynein axonemal heavy chain 11 OS=Sus scrofa OX=9823 GN=DNAH11 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00619 CARD	1.7e+02	13.6	Caspase recruitment domain
2	PF08385 DHC_N1	4.3e-169	575.4	Dynein heavy chain, N-terminal region 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265104

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400252	0.983	Dynein intermediate chain 2, axonemal
2	9606.ENSP00000480538	0.965	Dynein intermediate chain 1, axonemal
3	9606.ENSP00000318429	0.953	Coiled-coil domain-containing protein 114
4	9606.ENSP00000452037	0.948	Dynein light chain 1, axonemal
5	9606.ENSP00000380378	0.940	Platelet-activating factor acetylhydrolase IB subunit alpha
6	9606.ENSP00000354791	0.936	Dynactin subunit 1
7	9606.ENSP00000479322	0.933	CAP-Gly domain-containing linker protein 1
8	9606.ENSP00000408910	0.926	Dynactin subunit 2
9	9606.ENSP00000374045	0.924	Dynein heavy chain 6, axonemal
10	9606.ENSP00000261383	0.917	Dynein heavy chain 3, axonemal
11	9606.ENSP00000401514	0.917	Dynein heavy chain 1, axonemal
12	9606.ENSP00000296218	0.911	Axonemal dynein light intermediate polypeptide 1
13	9606.ENSP00000333363	0.902	Dynein heavy chain 8, axonemal
14	9606.ENSP00000259632	0.901	Dynactin subunit 3
15	9606.ENSP00000221114	0.900	Dynactin subunit 6
16	9606.ENSP00000380679	0.891	Coiled-coil domain-containing protein 40
17	9606.ENSP00000199447	0.879	Thioredoxin domain-containing protein 3
18	9606.ENSP00000391692	0.878	Coiled-coil domain containing 103
19	9606.ENSP00000391869	0.878	annotation not available
20	9606.ENSP00000229554	0.860	Radial spoke head protein 4 homolog A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003777	1.000	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009799	0.986	specification of symmetry
GO:0060972	0.986	left/right pattern formation
GO:0007017	0.966	microtubule-based process
GO:0003341	0.951	cilium movement
GO:0009855	0.901	determination of bilateral symmetry
GO:0007368	0.889	determination of left/right symmetry
GO:0000226	0.362	microtubule cytoskeleton organization
GO:0044782	0.337	cilium organization
GO:0035082	0.325	axoneme assembly
GO:0070286	0.304	axonemal dynein complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005930	1.000	axoneme
GO:0097729	0.997	9+2 motile cilium
GO:0005875	0.995	microtubule associated complex
GO:0005858	0.986	axonemal dynein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]