StarFunc result for job id Q8TE82

User Input

>input (1336 residues)
MENLPAVTTEEPTPMGRGPVGPSGGGSTRDQVRTVVMRPSVSWEKAGPEEAKAPVRGDEA
PPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQTLRGQLRLLENDSREM
ARVLGELSARLLSIHSDQDRIVVTFKTFEEIWKFSTYHALGFTHHCLANLLMDQAFWLLL
PSEEEETAIQVHVDENALRLTHESLLIQEGPFFVLCPDHHVRVMTGPRDAGNGPQALRQA
SGAPQGEAAPETDSSPPSPSVSSEEVAVAAAPEPLIPFHQWALRIPQDPIDDAMGGPVMP
GNPLMAVGLASALADFQGSGPEEMTFRGGDLIEILGAQVPSLPWCVGRHAASGRVGFVRS
SLISMQGPVSELESAIFLNEEEKSFFSEGCFSEEDARQLLRRMSGTDVCSVYSLDSVEEA
ETEQPQEKEIPPPCLSLEPQETLQKVKNVLEQCKTCPGCPQEPASWGLCAASSDVSLQDP
EEPSFCLEAEDDWEDPEALSSLLLFLNAPGYKASFRGLYDVALPWLSSVFRSFSDEEELT
GRLAQARGAAKKAGLLMALARLCFLLGRLCSRRLKLSQARVYFEEALGALEGSFGDLFLV
VAVYANLASIYRKQKNREKCAQVVPKAMALLLGTPDHICSTEAEGELLQLALRRAVGGQS
LQAEARACFLLARHHVHLKQPEEALPFLERLLLLHRDSGAPEAAWLSDCYLLLADIYSRK
CLPHLVLSCVKVASLRTRGSLAGSLRSVNLVLQNAPQPHSLPAQTSHYLRQALASLTPGT
GQALRGPLYTSLAQLYSHHGCHGPAITFMTQAVEASAIAGVRAIVDHLVALAWLHVLHGQ
SPVALDILQSVRDAVVASEDQEGVIANMVAVALKRTGRTRQAAESYYRALRVARDLGQQR
NQAVGLANFGALCLHAGASRLAQHYLLEAVRLFSRLPLGECGRDFTHVLLQLGHLCTRQG
PAQQGKGYYEWALLVAVEMGHVESQLRAVQRLCHFYSAVMPSEAQCVIYHELQLSLACKV
ADKVLEGQLLETISQLYLSLGTERAYKSALDYTKRSLGIFIDLQKKEKEAHAWLQAGKIY
YILRQSELVDLYIQVAQNVALYTGDPNLGLELFEAAGDIFFDGAWEREKAVSFYRDRALP
LAVTTGNRKAELRLCNKLVALLATLEEPQEGLEFAHMALALSITLGDRLNERVAYHRLAA
LQHRLGHGELAEHFYLKALSLCNSPLEFDEETLYYVKVYLVLGDIIFYDLKDPFDAAGYY
QLALAAAVDLGNKKAQLKIYTRLATIYHNFLLDREKSLFFYQKARTFATELNVRRVNLPP
LPLCGWAPWLAPSHPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80VA5	0.740	0.765	1.776E-65	1289	0.347	0.360	Q80VA5.pdb.gz	S3TC2_MOUSE SH3 domain and tetratricopeptide repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Sh3tc2 PE=1 SV=2
2	AFDB:Q96AY4	0.266	0.163	1.056E-18	2481	0.106	0.057	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
3	AFDB:O94474	0.160	0.155	1.088E-11	1389	0.091	0.087	O94474.pdb.gz	SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ski3 PE=3 SV=1
4	AFDB:Q0HA38	0.257	0.260	3.876E-11	1315	0.095	0.097	Q0HA38.pdb.gz	TT21B_MOUSE Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1
5	AFDB:Q7Z4L5	0.234	0.237	1.716E-10	1316	0.104	0.106	Q7Z4L5.pdb.gz	TT21B_HUMAN Tetratricopeptide repeat protein 21B OS=Homo sapiens OX=9606 GN=TTC21B PE=1 SV=2
6	PDB:4bujB	0.170	0.167	6.589E-10	1367	0.080	0.078	4bujB.pdb.gz
7	PDB:7qdrB	0.163	0.175	1.136E-9	1212	0.096	0.106	7qdrB.pdb.gz
8	AFDB:P17883	0.152	0.143	1.460E-9	1432	0.085	0.080	P17883.pdb.gz	SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI3 PE=1 SV=2
9	AFDB:F1QVN7	0.144	0.198	2.024E-9	855	0.085	0.133	F1QVN7.pdb.gz
10	PDB:6tedQ	0.171	0.228	2.813E-9	890	0.090	0.135	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
11	AFDB:Q9LII8	0.193	0.364	3.363E-9	663	0.087	0.175	Q9LII8.pdb.gz	KLCR2_ARATH Protein KINESIN LIGHT CHAIN-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=KLCR2 PE=1 SV=1
12	AFDB:Q57WP4	0.153	0.267	5.391E-9	673	0.079	0.158	Q57WP4.pdb.gz	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
13	AFDB:O81629	0.208	0.381	6.702E-9	609	0.063	0.138	O81629.pdb.gz	KLCR1_ARATH Protein KINESIN LIGHT CHAIN-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=KLCR1 PE=1 SV=1
14	PDB:7dkhI	0.134	0.185	2.574E-8	914	0.088	0.128	7dkhI.pdb.gz
15	PDB:7sqcR1	0.158	0.132	1.964E-7	2080	0.109	0.070	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:6bq1B	0.180	0.289	3.384E-7	728	0.090	0.165	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
17	PDB:7ntfA	0.187	0.246	4.363E-7	918	0.062	0.090	7ntfA.pdb.gz
18	PDB:5dseA	0.152	0.283	1.162E-6	537	0.067	0.168	5dseA.pdb.gz
19	PDB:7n6g1N	0.213	0.152	2.154E-6	2179	0.105	0.064	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
20	PDB:8a3tJ	0.162	0.386	2.154E-6	509	0.049	0.130	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80VA5	0.0	671	1289	0.344	0.357	S3TC2_MOUSE SH3 domain and tetratricopeptide repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Sh3tc2 PE=1 SV=2
2	F6QN66	1.00e-11	72.4	2481	0.103	0.056	F6QN66_MACMU Tetratricopeptide repeat domain 28 OS=Macaca mulatta OX=9544 GN=TTC28 PE=4 SV=1
3	Q96AY4	1.11e-11	72.4	2481	0.103	0.056	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
4	Q9VB22	2.22e-07	57.8	658	0.052	0.106	Q9VB22_DROME LD33695p OS=Drosophila melanogaster OX=7227 GN=pins PE=1 SV=1
5	Q9NH88	2.28e-07	57.8	658	0.052	0.106	Q9NH88_DROME Partner of Inscuteable OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
6	Q9NFR7	2.38e-07	57.8	658	0.052	0.106	Q9NFR7_DROME Rapsynoid OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
7	A0A0A0MSK4	6.59e-07	56.2	675	0.057	0.113	A0A0A0MSK4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=1
8	Q86YR5	6.93e-07	56.2	675	0.057	0.113	GPSM1_HUMAN G-protein-signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
9	A0A0A0MRC4	2.14e-06	54.7	707	0.051	0.096	A0A0A0MRC4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
10	Q9R080	6.17e-05	50.1	673	0.055	0.110	GPSM1_RAT G-protein-signaling modulator 1 OS=Rattus norvegicus OX=10116 GN=Gpsm1 PE=1 SV=2
11	Q6IR34	7.07e-05	49.7	673	0.055	0.110	GPSM1_MOUSE G-protein-signaling modulator 1 OS=Mus musculus OX=10090 GN=Gpsm1 PE=1 SV=3
12	P81274	0.001	46.2	684	0.040	0.079	GPSM2_HUMAN G-protein-signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=3
13	H0Y4A4	0.003	44.7	627	0.041	0.088	H0Y4A4_HUMAN G protein signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=2
14	Q8VDU0	0.003	44.3	679	0.040	0.080	GPSM2_MOUSE G-protein-signaling modulator 2 OS=Mus musculus OX=10090 GN=Gpsm2 PE=1 SV=2
15	Q13588	0.014	40.8	217	0.016	0.101	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
16	Q9LII8	0.052	40.4	663	0.049	0.100	KLCR2_ARATH Protein KINESIN LIGHT CHAIN-RELATED 2 OS=Arabidopsis thaliana OX=3702 GN=KLCR2 PE=1 SV=1
17	A0A0B4KH28	0.062	40.0	495	0.016	0.044	A0A0B4KH28_DROME Syndapin, isoform C OS=Drosophila melanogaster OX=7227 GN=Synd PE=1 SV=1
18	Q9VDI1	0.063	40.0	494	0.016	0.045	Q9VDI1_DROME LD46328p OS=Drosophila melanogaster OX=7227 GN=Synd PE=1 SV=2
19	Q6TXD4	0.14	39.3	1580	0.018	0.015	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
20	Q10199	0.27	38.1	670	0.016	0.033	IMP2_SCHPO Septation protein imp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18059 Csd3_N	3.4e+02	13.0	Csd3 N-terminal
2	PF00018 SH3_1	0.088	23.7	SH3 domain
3	PF07653 SH3_2	13	17.0	Variant SH3 domain
4	PF00515 TPR_1	0.026	25.5	Tetratricopeptide repeat
5	PF13374 TPR_10	0.26	22.4	Tetratricopeptide repeat
6	PF13424 TPR_12	3.6e-18	77.0	Tetratricopeptide repeat
7	PF14559 TPR_19	5.4e+02	12.5	Tetratricopeptide repeat
8	PF07719 TPR_2	0.054	24.7	Tetratricopeptide repeat
9	PF13176 TPR_7	0.00012	32.9	Tetratricopeptide repeat
10	PF13181 TPR_8	2.7e-07	41.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245105

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433205	0.708	BRCA2-interacting transcriptional repressor EMSY
2	9606.ENSP00000370621	0.652	Zinc finger BED domain-containing protein 1
3	9606.ENSP00000393511	0.631	Actin-binding LIM protein 2
4	9606.ENSP00000410689	0.626	Actin filament-associated protein 1
5	9606.ENSP00000266014	0.612	Glycosyltransferase 8 domain containing 1
6	9606.ENSP00000370299	0.606	Protein Shroom2
7	9606.ENSP00000422185	0.601	Sortilin related VPS10 domain containing receptor 2
8	9606.ENSP00000355890	0.578	Bifunctional glutamate/proline--tRNA ligase
9	9606.ENSP00000402505	0.547	C3 and PZP like, alpha-2-macroglobulin domain containing 8
10	9606.ENSP00000317445	0.538	Proactivator polypeptide-like 1
11	9606.ENSP00000363727	0.501	StAR-related lipid transfer protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0050789	0.976	regulation of biological process
GO:0050794	0.955	regulation of cellular process
GO:0071840	0.647	cellular component organization or biogenesis
GO:0016043	0.634	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.998	membrane
GO:0071944	0.995	cell periphery
GO:0005886	0.986	plasma membrane
GO:0005829	0.978	cytosol
GO:0031974	0.960	membrane-enclosed lumen
GO:0043233	0.945	organelle lumen
GO:0070013	0.944	intracellular organelle lumen
GO:0031981	0.921	nuclear lumen
GO:0043228	0.757	non-membrane-bounded organelle
GO:0043232	0.753	intracellular non-membrane-bounded organelle
GO:0031982	0.618	vesicle
GO:0031410	0.507	cytoplasmic vesicle
GO:0005654	0.391	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]