StarFunc result for job id Q8TE99

User Input

>input (480 residues)
MLFRNRFLLLLALAALLAFVSLSLQFFHLIPVSTPKNGMSSKSRKRIMPDPVTEPPVTDP
VYEALLYCNIPSVAERSMEGHAPHHFKLVSVHVFIRHGDRYPLYVIPKTKRPEIDCTLVA
NRKPYHPKLEAFISHMSKGSGASFESPLNSLPLYPNHPLCEMGELTQTGVVQHLQNGQLL
RDIYLKKHKLLPNDWSADQLYLETTGKSRTLQSGLALLYGFLPDFDWKKIYFRHQPSALF
CSGSCYCPVRNQYLEKEQRRQYLLRLKNSQLEKTYGEMAKIVDVPTKQLRAANPIDSMLC
HFCHNVSFPCTRNGCVDMEHFKVIKTHQIEDERERREKKLYFGYSLLGAHPILNQTIGRM
QRATEGRKEELFALYSAHDVTLSPVLSALGLSEARFPRFAARLIFELWQDREKPSEHSVR
ILYNGVDVTFHTSFCQDHHKRSPKPMCPLENLVRFVKRDMFVALGGSGTNYYDACHREGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TE99	1.000	1.000	1.189E-90	480	1.000	1.000	Q8TE99.pdb.gz	PXYP1_HUMAN 2-phosphoxylose phosphatase 1 OS=Homo sapiens OX=9606 GN=PXYLP1 PE=1 SV=1
2	AFDB:Q54PR9	0.629	0.718	3.165E-19	416	0.190	0.219	Q54PR9.pdb.gz	CF60_DICDI Counting factor 60 OS=Dictyostelium discoideum OX=44689 GN=cf60 PE=1 SV=1
3	AFDB:Q9NPH0	0.537	0.597	4.409E-17	428	0.190	0.213	Q9NPH0.pdb.gz	PPA6_HUMAN Lysophosphatidic acid phosphatase type 6 OS=Homo sapiens OX=9606 GN=ACP6 PE=1 SV=3
4	AFDB:Q8BP40	0.546	0.619	8.394E-17	418	0.185	0.213	Q8BP40.pdb.gz	PPA6_MOUSE Lysophosphatidic acid phosphatase type 6 OS=Mus musculus OX=10090 GN=Acp6 PE=1 SV=1
5	PDB:4jodA	0.560	0.695	7.793E-16	378	0.177	0.225	4jodA.pdb.gz
6	AFDB:Q19076	0.501	0.531	1.886E-15	449	0.173	0.185	Q19076.pdb.gz	PHO1_CAEEL Intestinal acid phosphatase OS=Caenorhabditis elegans OX=6239 GN=pho-1 PE=1 SV=1
7	AFDB:Q9USS6	0.590	0.611	2.215E-15	462	0.208	0.216	Q9USS6.pdb.gz	PPA4_SCHPO Probable acid phosphatase SPBC4.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4.06 PE=3 SV=1
8	AFDB:P20646	0.511	0.631	2.897E-15	381	0.181	0.228	P20646.pdb.gz	PPAP_RAT Prostatic acid phosphatase OS=Rattus norvegicus OX=10116 GN=Acp3 PE=1 SV=2
9	AFDB:P15309	0.517	0.630	6.479E-15	386	0.175	0.218	P15309.pdb.gz	PPAP_HUMAN Prostatic acid phosphatase OS=Homo sapiens OX=9606 GN=ACP3 PE=1 SV=3
10	AFDB:A6H730	0.506	0.614	1.373E-14	387	0.181	0.225	A6H730.pdb.gz	PPAP_BOVIN Prostatic acid phosphatase OS=Bos taurus OX=9913 GN=ACP3 PE=2 SV=1
11	AFDB:Q9BZG2	0.485	0.539	1.796E-14	426	0.183	0.207	Q9BZG2.pdb.gz	PPAT_HUMAN Testicular acid phosphatase OS=Homo sapiens OX=9606 GN=ACP4 PE=1 SV=1
12	PDB:1nd6B	0.513	0.696	1.949E-14	343	0.160	0.224	1nd6B.pdb.gz	Crystal structures of human prostatic acid phosphatase in complex with a phosphate ion and alpha-benzylaminobenzylphosphonic acid update the mechanistic picture and offer new insights into inhibitor design
13	PDB:1rptA	0.506	0.686	8.379E-12	342	0.169	0.237	1rptA.pdb.gz	Crystal structures of rat acid phosphatase complexed with the transition-state analogs vanadate and molybdate. Implications for the reaction mechanism.
14	PDB:1nt4A	0.416	0.497	2.598E-10	391	0.135	0.166	1nt4A.pdb.gz	Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase.
15	PDB:7z32A	0.432	0.492	2.767E-8	412	0.135	0.158	7z32A.pdb.gz
16	PDB:1yjxA	0.219	0.394	2.545E-3	245	0.090	0.176	1yjxA.pdb.gz	Crystal structure of human B-type phosphoglycerate mutase bound with citrate.
17	PDB:4embA	0.232	0.417	3.154E-3	245	0.077	0.151	4embA.pdb.gz
18	PDB:1qhfA	0.221	0.409	5.691E-3	240	0.096	0.192	1qhfA.pdb.gz	Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A.
19	PDB:3lg2A	0.127	0.213	1.955E-2	269	0.046	0.082	3lg2A.pdb.gz	Structure and activity of the metal-independent fructose-1,6-bisphosphatase YK23 from Saccharomyces cerevisiae.
20	PDB:6s2rA	0.286	0.530	3.169E-2	234	0.062	0.128	6s2rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TE99	0.0	1000	480	1.000	1.000	PXYP1_HUMAN 2-phosphoxylose phosphatase 1 OS=Homo sapiens OX=9606 GN=PXYLP1 PE=1 SV=1
2	Q54PR9	3.41e-15	79.7	416	0.212	0.245	CF60_DICDI Counting factor 60 OS=Dictyostelium discoideum OX=44689 GN=cf60 PE=1 SV=1
3	Q9USS6	1.66e-14	77.8	462	0.194	0.201	PPA4_SCHPO Probable acid phosphatase SPBC4.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4.06 PE=3 SV=1
4	Q8BP40	3.86e-11	67.0	418	0.200	0.230	PPA6_MOUSE Lysophosphatidic acid phosphatase type 6 OS=Mus musculus OX=10090 GN=Acp6 PE=1 SV=1
5	P15309	3.35e-10	63.9	386	0.165	0.205	PPAP_HUMAN Prostatic acid phosphatase OS=Homo sapiens OX=9606 GN=ACP3 PE=1 SV=3
6	A6H730	3.52e-10	63.9	387	0.158	0.196	PPAP_BOVIN Prostatic acid phosphatase OS=Bos taurus OX=9913 GN=ACP3 PE=2 SV=1
7	P20646	8.61e-10	62.8	381	0.146	0.184	PPAP_RAT Prostatic acid phosphatase OS=Rattus norvegicus OX=10116 GN=Acp3 PE=1 SV=2
8	Q9NPH0	9.49e-10	62.8	428	0.185	0.208	PPA6_HUMAN Lysophosphatidic acid phosphatase type 6 OS=Homo sapiens OX=9606 GN=ACP6 PE=1 SV=3
9	P20611	1.47e-09	62.4	423	0.175	0.199	PPAL_RAT Lysosomal acid phosphatase OS=Rattus norvegicus OX=10116 GN=Acp2 PE=1 SV=1
10	P24638	2.76e-09	61.2	423	0.177	0.201	PPAL_MOUSE Lysosomal acid phosphatase OS=Mus musculus OX=10090 GN=Acp2 PE=1 SV=2
11	Q8CE08	7.92e-09	59.7	381	0.138	0.173	PPAP_MOUSE Prostatic acid phosphatase OS=Mus musculus OX=10090 GN=Acp3 PE=1 SV=1
12	Q9VAD0	1.31e-07	56.2	438	0.135	0.148	Q9VAD0_DROME Acid phosphatase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Acph-1 PE=1 SV=1
13	Q8I0P9	1.39e-07	56.2	455	0.135	0.143	Q8I0P9_DROME Acid phosphatase 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Acph-1 PE=1 SV=1
14	A0A0G2KB67	3.59e-07	55.1	487	0.200	0.197	A0A0G2KB67_RAT Acid phosphatase 4 OS=Rattus norvegicus OX=10116 GN=Acp4 PE=4 SV=2
15	Q9BZG2	4.47e-07	54.3	426	0.194	0.218	PPAT_HUMAN Testicular acid phosphatase OS=Homo sapiens OX=9606 GN=ACP4 PE=1 SV=1
16	P11117	5.15e-07	54.3	423	0.167	0.189	PPAL_HUMAN Lysosomal acid phosphatase OS=Homo sapiens OX=9606 GN=ACP2 PE=1 SV=3
17	Q19076	3.38e-05	48.5	449	0.135	0.145	PHO1_CAEEL Intestinal acid phosphatase OS=Caenorhabditis elegans OX=6239 GN=pho-1 PE=1 SV=1
18	O57861	0.25	36.6	1431	0.067	0.022	DP2L_PYRHO DNA polymerase II large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=polC PE=1 SV=2
19	Q21952	0.93	34.3	490	0.056	0.055	NUF2_CAEEL Kinetochore protein Nuf2 homolog OS=Caenorhabditis elegans OX=6239 GN=him-10 PE=1 SV=1
20	O13982	2.2	33.1	399	0.048	0.058	YEC8_SCHPO Uncharacterized WD repeat-containing protein C25H1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC25H1.08c PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00328 His_Phos_2	1.8e-24	98.4	Histidine phosphatase superfamily (branch 2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286353

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360660	0.528	Neural proliferation differentiation and control protein 1
2	9606.ENSP00000376224	0.516	Transmembrane protein 200A
3	9606.ENSP00000454783	0.516	Coronin-2B
4	9606.ENSP00000477653	0.514	Dual specificity protein phosphatase 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016791	1.000	phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044237	0.990	cellular metabolic process
GO:1901137	0.981	carbohydrate derivative biosynthetic process
GO:1901566	0.980	organonitrogen compound biosynthetic process
GO:1903018	0.980	regulation of glycoprotein metabolic process
GO:0009059	0.979	macromolecule biosynthetic process
GO:2000112	0.978	regulation of cellular macromolecule biosynthetic process
GO:0009100	0.975	glycoprotein metabolic process
GO:0034645	0.972	cellular macromolecule biosynthetic process
GO:0048518	0.970	positive regulation of biological process
GO:0006022	0.955	aminoglycan metabolic process
GO:0009101	0.953	glycoprotein biosynthetic process
GO:0042762	0.941	regulation of sulfur metabolic process
GO:0050654	0.941	chondroitin sulfate proteoglycan metabolic process
GO:0030166	0.940	proteoglycan biosynthetic process
GO:0048522	0.931	positive regulation of cellular process
GO:0050650	0.924	chondroitin sulfate proteoglycan biosynthetic process
GO:0030203	0.921	glycosaminoglycan metabolic process
GO:0006023	0.868	aminoglycan biosynthetic process
GO:0009893	0.801	positive regulation of metabolic process
GO:0051173	0.595	positive regulation of nitrogen compound metabolic process
GO:0010604	0.573	positive regulation of macromolecule metabolic process
GO:0009891	0.549	positive regulation of biosynthetic process
GO:0051247	0.473	positive regulation of protein metabolic process
GO:0031328	0.445	positive regulation of cellular biosynthetic process
GO:0006024	0.445	glycosaminoglycan biosynthetic process
GO:0010559	0.438	regulation of glycoprotein biosynthetic process
GO:0010557	0.398	positive regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0005794	0.989	Golgi apparatus
GO:0070013	0.421	intracellular organelle lumen
GO:0016020	0.398	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]