StarFunc result for job id Q8TEA7

User Input

>input (893 residues)
MFPLKDAEMGAFTFFASALPHDVCGSNGLPLTPNSIKILGRFQILKTITHPRLCQYVDIS
RGKHERLVVVAEHCERSLEDLLRERKPVSCSTVLCIAFEVLQGLQYMNKHGIVHRALSPH
NILLDRKGHIKLAKFGLYHMTAHGDDVDFPIGYPSYLAPEVIAQGIFKTTDHMPSKKPLP
SGPKSDVWSLGIILFELCVGRKLFQSLDISERLKFLLTLDCVDDTLIVLAEEHGCLDIIK
ELPETVIDLLNKCLTFHPSKRPTPDQLMKDKVFSEVSPLYTPFTKPASLFSSSLRCADLT
LPEDISQLCKDINNDYLAERSIEEVYYLWCLAGGDLEKELVNKEIIRSKPPICTLPNFLF
EDGESFGQGRDRSSLLDDTTVTLSLCQLRNRLKDVGGEAFYPLLEDDQSNLPHSNSNNEL
SAAATLPLIIREKDTEYQLNRIILFDRLLKAYPYKKNQIWKEARVDIPPLMRGLTWAALL
GVEGAIHAKYDAIDKDTPIPTDRQIEVDIPRCHQYDELLSSPEGHAKFRRVLKAWVVSHP
DLVYWQGLDSLCAPFLYLNFNNEALAYACMSAFIPKYLYNFFLKDNSHVIQEYLTVFSQM
IAFHDPELSNHLNEIGFIPDLYAIPWFLTMFTHVFPLHKIFHLWDTLLLGNSSFPFCIGV
AILQQLRDRLLANGFNECILLFSDLPEIDIERCVRESINLFCWTPKSATYRQHAQPPKPS
SDSSGGRSSAPYFSAECPDPPKTDLSRESIPLNDLKSEVSPRISAEDLIDLCELTVTGHF
KTPSKKTKSSKPKLLVVDIRNSEDFIRGHISGSINIPFSAAFTAEGELTQGPYTAMLQNF
KGKVIVIVGHVAKHTAEFAAHLVKMKYPRICILDGGINKIKPTGLLTIPSPQI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEA7	1.000	1.000	0.000	893	1.000	1.000	Q8TEA7.pdb.gz	TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=TBCK PE=1 SV=4
2	AFDB:Q9W4F8	0.857	0.932	5.117E-71	819	0.430	0.469	Q9W4F8.pdb.gz	Q9W4F8_DROME LD42868p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4041 PE=2 SV=4
3	AFDB:Q9VPW9	0.385	0.491	1.859E-12	689	0.097	0.126	Q9VPW9.pdb.gz	Q9VPW9_DROME TBC1 domain family member 23 OS=Drosophila melanogaster OX=7227 GN=TBC1D23 PE=1 SV=2
4	AFDB:Q9NUY8	0.376	0.471	1.386E-11	699	0.101	0.129	Q9NUY8.pdb.gz	TBC23_HUMAN TBC1 domain family member 23 OS=Homo sapiens OX=9606 GN=TBC1D23 PE=1 SV=3
5	AFDB:Q7SXV1	0.370	0.477	2.072E-11	680	0.094	0.124	Q7SXV1.pdb.gz	TBC23_DANRE TBC1 domain family member 23 OS=Danio rerio OX=7955 GN=tbc1d23 PE=2 SV=1
6	AFDB:Q00372	0.205	0.293	1.615E-10	612	0.104	0.152	Q00372.pdb.gz	SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SNF1 PE=3 SV=2
7	AFDB:Q38A97	0.271	0.556	1.847E-10	418	0.082	0.175	Q38A97.pdb.gz	Q38A97_TRYB2 GTPase activating protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1770 PE=4 SV=1
8	AFDB:A0A0B4J2F2	0.226	0.254	2.640E-10	783	0.091	0.103	A0A0B4J2F2.pdb.gz	SIK1B_HUMAN Putative serine/threonine-protein kinase SIK1B OS=Homo sapiens OX=9606 GN=SIK1B PE=5 SV=1
9	AFDB:Q60670	0.228	0.258	2.886E-10	779	0.095	0.109	Q60670.pdb.gz	SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus OX=10090 GN=Sik1 PE=1 SV=3
10	AFDB:Q382D0	0.210	0.160	3.018E-10	1195	0.073	0.054	Q382D0.pdb.gz	Q382D0_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5650 PE=4 SV=1
11	PDB:4rerA	0.210	0.388	4.890E-10	459	0.085	0.166	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
12	PDB:4krcA	0.209	0.581	1.561E-9	297	0.069	0.209	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
13	PDB:4d28C	0.215	0.636	3.335E-9	279	0.062	0.197	4d28C.pdb.gz
14	PDB:4tthB	0.206	0.653	3.335E-9	256	0.083	0.289	4tthB.pdb.gz	Discovery of AMG 925, a FLT3 and CDK4 dual kinase inhibitor with preferential affinity for the activated state of FLT3.
15	PDB:2b9iA	0.212	0.525	3.488E-9	338	0.062	0.163	2b9iA.pdb.gz	The role of docking interactions in mediating signaling input, output, and discrimination in the yeast MAPK network.
16	PDB:4cztD	0.211	0.582	3.488E-9	302	0.071	0.209	4cztD.pdb.gz
17	PDB:3eqdA	0.214	0.574	3.814E-9	315	0.071	0.200	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
18	PDB:2w96B	0.219	0.658	4.985E-9	267	0.077	0.258	2w96B.pdb.gz
19	PDB:4zhxA	0.212	0.439	5.960E-9	409	0.083	0.181	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
20	PDB:4yc3A	0.213	0.597	6.517E-9	295	0.068	0.207	4yc3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TEA7	0.0	1837	893	1.000	1.000	TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens OX=9606 GN=TBCK PE=1 SV=4
2	Q9W4F8	0.0	685	819	0.429	0.468	Q9W4F8_DROME LD42868p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4041 PE=2 SV=4
3	Q54UM5	7.02e-21	100	733	0.082	0.100	Q54UM5_DICDI RabGAP/TBC domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280955 PE=4 SV=2
4	C8VT14	3.07e-20	99.4	1313	0.076	0.052	C8VT14_EMENI MAP kinase kinase kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sskB PE=3 SV=1
5	Q00372	6.03e-20	97.4	612	0.090	0.131	SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SNF1 PE=3 SV=2
6	A0A1D8PN61	8.13e-20	97.1	618	0.072	0.104	A0A1D8PN61_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF1 PE=4 SV=1
7	F1MA87	1.45e-19	93.2	326	0.095	0.261	F1MA87_RAT Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=2
8	Q00534	3.06e-19	92.0	326	0.094	0.258	CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1
9	P06782	6.18e-19	94.4	633	0.073	0.103	SNF1_YEAST Carbon catabolite-derepressing protein kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF1 PE=1 SV=1
10	Q64261	1.72e-18	89.7	326	0.093	0.255	CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus OX=10090 GN=Cdk6 PE=1 SV=2
11	Q38B72	4.46e-18	91.7	729	0.066	0.081	Q38B72_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1760 PE=4 SV=1
12	Q12263	4.68e-18	92.0	1142	0.080	0.062	GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIN4 PE=1 SV=1
13	Q5ABG0	5.30e-18	91.3	653	0.080	0.109	Q5ABG0_CANAL Serine/threonine-protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC5 PE=3 SV=1
14	P50528	1.02e-17	90.5	683	0.068	0.089	PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=plo1 PE=1 SV=1
15	Q55FT4	2.26e-17	90.1	2247	0.069	0.028	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1
16	Q9UEW8	7.24e-17	87.4	545	0.081	0.132	STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens OX=9606 GN=STK39 PE=1 SV=3
17	P92958	7.51e-17	87.0	512	0.071	0.123	KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana OX=3702 GN=KIN11 PE=1 SV=1
18	O88506	7.78e-17	87.0	553	0.081	0.130	STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus OX=10116 GN=Stk39 PE=1 SV=2
19	O18645	8.37e-17	87.0	582	0.069	0.107	O18645_DROME AMP-activated protein kinase alpha subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=AMPKalpha PE=1 SV=1
20	Q9Z1W9	8.58e-17	87.0	556	0.081	0.129	STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus OX=10090 GN=Stk39 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14531 Kinase-like	0.015	26.2	Kinase-like
2	PF00069 Pkinase	1.2e-34	131.5	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.8e-23	94.7	Protein tyrosine and serine/threonine kinase
4	PF00566 RabGAP-TBC	2e-39	147.0	Rab-GTPase-TBC domain
5	PF00581 Rhodanese	4.6e-09	48.1	Rhodanese-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000273980

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383599	0.732	WD repeat-containing protein 47
2	9606.ENSP00000264515	0.677	Retinoblastoma-binding protein 5
3	9606.ENSP00000416658	0.649	Nucleoside diphosphate kinase 6
4	9606.ENSP00000270792	0.646	SH3 domain-binding glutamic acid-rich-like protein 3
5	9606.ENSP00000439182	0.612	Unconventional myosin-Ih
6	9606.ENSP00000348128	0.604	Supervillin
7	9606.ENSP00000478303	0.600	DNA-directed RNA polymerases I, II, and III subunit RPABC1
8	9606.ENSP00000409171	0.596	Plexin-B2
9	9606.ENSP00000273308	0.582	Protein canopy homolog 2
10	9606.ENSP00000368965	0.574	Heparan-alpha-glucosaminide N-acetyltransferase
11	9606.ENSP00000350686	0.542	Ankyrin repeat and LEM domain-containing protein 2
12	9606.ENSP00000302895	0.531	Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2
13	9606.ENSP00000483467	0.529	Uncharacterized serine/threonine-protein kinase SBK3
14	9606.ENSP00000264866	0.527	TBC1 domain family member 19
15	9606.ENSP00000339918	0.525	X-ray radiation resistance-associated protein 1
16	9606.ENSP00000351113	0.524	Protein furry homolog-like
17	9606.ENSP00000261250	0.505	Protein C12orf4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004672	1.000	protein kinase activity
GO:0004674	0.968	protein serine/threonine kinase activity
GO:0019899	0.392	enzyme binding
GO:0098772	0.316	molecular function regulator activity
GO:0030234	0.312	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0009987	0.995	cellular process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0071840	0.927	cellular component organization or biogenesis
GO:0016043	0.917	cellular component organization
GO:0032006	0.836	regulation of TOR signaling
GO:0006996	0.832	organelle organization
GO:0007010	0.811	cytoskeleton organization
GO:0030029	0.576	actin filament-based process
GO:0008283	0.562	cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0015630	0.972	microtubule cytoskeleton
GO:0043227	0.875	membrane-bounded organelle
GO:0043231	0.871	intracellular membrane-bounded organelle
GO:0005829	0.801	cytosol
GO:0030496	0.751	midbody
GO:0005819	0.723	spindle
GO:0012505	0.626	endomembrane system
GO:0032991	0.431	protein-containing complex
GO:0072686	0.386	mitotic spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]