StarFunc result for job id Q8TEB7

User Input

>input (428 residues)
MGPPPGAGVSCRGGCGFSRLLAWCFLLALSPQAPGSRGAEAVWTAYLNVSWRVPHTGVNR
TVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNPHTNFTVPTVWGSTVQVSWLALI
QRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPMSHPGAVDIVAIMIGNLKGTKIL
QSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFIITAATVGYFIFYSARRLRNARAQ
SRKQRQLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKPNDLVRILTCNHIFH
KTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSE
TASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQE
TAVREIKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEB7	1.000	1.000	1.380E-82	428	1.000	1.000	Q8TEB7.pdb.gz	RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens OX=9606 GN=RNF128 PE=1 SV=1
2	AFDB:Q14B02	0.462	0.509	1.738E-43	382	0.430	0.482	Q14B02.pdb.gz	RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus OX=10090 GN=Rnf133 PE=1 SV=1
3	AFDB:Q8NC42	0.443	0.470	1.683E-38	400	0.341	0.365	Q8NC42.pdb.gz	RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens OX=9606 GN=RNF149 PE=2 SV=2
4	AFDB:Q9ULK6	0.436	0.427	4.701E-38	438	0.386	0.377	Q9ULK6.pdb.gz	RN150_HUMAN RING finger protein 150 OS=Homo sapiens OX=9606 GN=RNF150 PE=1 SV=2
5	AFDB:Q86XS8	0.397	0.404	1.236E-37	419	0.332	0.339	Q86XS8.pdb.gz	GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens OX=9606 GN=RNF130 PE=1 SV=1
6	AFDB:Q3U2C5	0.421	0.454	2.004E-37	394	0.334	0.363	Q3U2C5.pdb.gz	RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus OX=10090 GN=Rnf149 PE=1 SV=3
7	AFDB:Q06003	0.478	0.449	3.126E-31	461	0.273	0.254	Q06003.pdb.gz	GOLI_DROME E3 ubiquitin-protein ligase goliath OS=Drosophila melanogaster OX=7227 GN=gol PE=1 SV=3
8	AFDB:Q9H6Y7	0.257	0.308	4.157E-19	350	0.196	0.240	Q9H6Y7.pdb.gz	RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens OX=9606 GN=RNF167 PE=1 SV=1
9	AFDB:O43567	0.265	0.291	1.310E-18	381	0.220	0.247	O43567.pdb.gz	RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
10	AFDB:Q5SSZ7	0.263	0.132	3.888E-18	913	0.178	0.083	Q5SSZ7.pdb.gz	ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus OX=10090 GN=Znrf3 PE=1 SV=1
11	PDB:7zqsB	0.216	0.150	1.831E-4	639	0.070	0.047	7zqsB.pdb.gz	Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
12	PDB:4tweA	0.206	0.135	6.470E-3	706	0.082	0.050	4tweA.pdb.gz	Structural and biochemical characterization of a novel aminopeptidase from human intestine.
13	PDB:1jdbF	0.187	0.206	1.336E-2	380	0.047	0.053	1jdbF.pdb.gz	The structure of carbamoyl phosphate synthetase determined to 2.1 A resolution.
14	PDB:6etyA	0.207	0.137	3.964E-2	696	0.072	0.045	6etyA.pdb.gz	Structural and computational basis for potent inhibition of glutamate carboxypeptidase II by carbamate-based inhibitors.
15	PDB:3fedA	0.145	0.098	7.706E-2	690	0.044	0.028	3fedA.pdb.gz	Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III
16	PDB:5gm6a	0.102	0.331	1.591E-1	123	0.030	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:7oniR	0.104	0.470	2.580E-1	86	0.037	0.186	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:2lgvA	0.097	0.387	2.912E-1	100	0.040	0.170	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
19	PDB:4a0cF	0.095	0.475	3.708E-1	80	0.035	0.188	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
20	PDB:4kwvF	0.083	0.112	5.016E-1	291	0.028	0.041	4kwvF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TEB7	0.0	887	428	1.000	1.000	RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens OX=9606 GN=RNF128 PE=1 SV=1
2	Q9D304	0.0	849	428	0.953	0.953	RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus OX=10090 GN=Rnf128 PE=1 SV=1
3	Q14B02	1.14e-120	358	382	0.407	0.455	RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus OX=10090 GN=Rnf133 PE=1 SV=1
4	Q9ULK6	1.26e-83	265	438	0.379	0.370	RN150_HUMAN RING finger protein 150 OS=Homo sapiens OX=9606 GN=RNF150 PE=1 SV=2
5	Q8NC42	3.08e-76	244	400	0.308	0.330	RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens OX=9606 GN=RNF149 PE=2 SV=2
6	Q3U2C5	6.40e-74	238	394	0.320	0.348	RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus OX=10090 GN=Rnf149 PE=1 SV=3
7	Q86XS8	3.46e-73	237	419	0.308	0.315	GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens OX=9606 GN=RNF130 PE=1 SV=1
8	Q8VEM1	7.31e-73	236	419	0.304	0.310	GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus OX=10090 GN=Rnf130 PE=2 SV=1
9	Q06003	1.80e-45	165	461	0.238	0.221	GOLI_DROME E3 ubiquitin-protein ligase goliath OS=Drosophila melanogaster OX=7227 GN=gol PE=1 SV=3
10	Q5NCP0	2.22e-19	93.2	784	0.136	0.074	RNF43_MOUSE E3 ubiquitin-protein ligase RNF43 OS=Mus musculus OX=10090 GN=Rnf43 PE=1 SV=1
11	Q68DV7	3.74e-18	89.4	783	0.138	0.075	RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens OX=9606 GN=RNF43 PE=1 SV=1
12	Q9M622	5.58e-17	83.6	310	0.152	0.210	RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=RMR1 PE=1 SV=1
13	O54965	1.94e-15	79.7	381	0.180	0.202	RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus OX=10090 GN=Rnf13 PE=1 SV=2
14	O43567	5.52e-15	78.2	381	0.182	0.205	RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
15	Q5SSZ7	2.06e-14	77.8	913	0.133	0.062	ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus OX=10090 GN=Znrf3 PE=1 SV=1
16	Q9ULT6	3.28e-14	77.0	936	0.129	0.059	ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens OX=9606 GN=ZNRF3 PE=1 SV=3
17	Q9H6Y7	7.59e-14	74.7	350	0.164	0.200	RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens OX=9606 GN=RNF167 PE=1 SV=1
18	Q9VI20	5.31e-13	72.8	536	0.124	0.099	GZL_DROME E3 ubiquitin-protein ligase Godzilla OS=Drosophila melanogaster OX=7227 GN=gzl PE=1 SV=1
19	Q08D68	8.10e-12	69.7	853	0.126	0.063	ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis OX=8364 GN=znrf3 PE=1 SV=1
20	O64763	1.45e-11	67.8	378	0.107	0.122	ATL9_ARATH E3 ubiquitin-protein ligase ATL9 OS=Arabidopsis thaliana OX=3702 GN=ATL9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06305 LapA_dom	4.1e+02	12.2	Lipopolysaccharide assembly protein A domain
2	PF02225 PA	0.0067	27.8	PA domain
3	PF00628 PHD	4.7e+02	12.1	PHD-finger
4	PF14447 Prok-RING_4	1.6e+02	13.6	Prokaryotic RING finger family 4
5	PF12861 zf-ANAPC11	76	14.8	Anaphase-promoting complex subunit 11 RING-H2 finger
6	PF17122 zf-C3H2C3	47	15.4	Zinc-finger
7	PF00097 zf-C3HC4	0.0024	29.0	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	0.00028	32.0	Zinc finger, C3HC4 type (RING finger)
9	PF13920 zf-C3HC4_3	5	18.4	Zinc finger, C3HC4 type (RING finger)
10	PF12678 zf-rbx1	0.00033	32.2	RING-H2 zinc finger domain
11	PF17123 zf-RING_11	0.00014	32.8	RING-like zinc finger
12	PF13639 zf-RING_2	5.6e-08	44.3	Ring finger domain
13	PF14634 zf-RING_5	0.0098	27.2	zinc-RING finger domain
14	PF13445 zf-RING_UBOX	0.12	23.7	RING-type zinc-finger
15	PF17034 zinc_ribbon_16	44	15.7	Zinc-ribbon like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000444357	0.944	Ubiquitin thioesterase OTUB1
2	9606.ENSP00000379721	0.911	Ubiquitin carboxyl-terminal hydrolase 8
3	9606.ENSP00000203664	0.837	Ubiquitin thioesterase OTUB2
4	9606.ENSP00000294179	0.645	Syntaxin-5
5	9606.ENSP00000329967	0.616	Serine/threonine-protein kinase TBK1
6	9606.ENSP00000298130	0.610	Serine palmitoyltransferase small subunit A
7	9606.ENSP00000303148	0.603	Voltage-dependent calcium channel gamma-like subunit
8	9606.ENSP00000316176	0.576	Ubiquitin-conjugating enzyme E2 N
9	9606.ENSP00000320898	0.546	E3 ubiquitin-protein ligase RNF168
10	9606.ENSP00000303434	0.516	Ubiquitin carboxyl-terminal hydrolase 38
11	9606.ENSP00000377895	0.512	F-box only protein 38
12	9606.ENSP00000265062	0.506	Ras-related protein Rab-7a
13	9606.ENSP00000479762	0.501	Ras-related protein Rab-7b
14	9606.ENSP00000296980	0.500	Interleukin-22 receptor subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0009987	0.983	cellular process
GO:0060255	0.921	regulation of macromolecule metabolic process
GO:0009894	0.821	regulation of catabolic process
GO:0048518	0.782	positive regulation of biological process
GO:0042176	0.782	regulation of protein catabolic process
GO:0050794	0.761	regulation of cellular process
GO:0051179	0.743	localization
GO:0009893	0.733	positive regulation of metabolic process
GO:0010604	0.686	positive regulation of macromolecule metabolic process
GO:0072665	0.676	protein localization to vacuole
GO:0061462	0.602	protein localization to lysosome
GO:0031647	0.585	regulation of protein stability
GO:0008152	0.579	metabolic process
GO:0071704	0.563	organic substance metabolic process
GO:0044238	0.515	primary metabolic process
GO:0006807	0.502	nitrogen compound metabolic process
GO:0048519	0.481	negative regulation of biological process
GO:0051173	0.478	positive regulation of nitrogen compound metabolic process
GO:0043170	0.461	macromolecule metabolic process
GO:0051247	0.415	positive regulation of protein metabolic process
GO:1901564	0.386	organonitrogen compound metabolic process
GO:0019538	0.369	protein metabolic process
GO:0048522	0.320	positive regulation of cellular process
GO:0070647	0.306	protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005829	0.981	cytosol
GO:0031982	0.936	vesicle
GO:0016020	0.892	membrane
GO:0005768	0.586	endosome
GO:0005783	0.550	endoplasmic reticulum
GO:0005770	0.307	late endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]