StarFunc result for job id Q8TEB9

User Input

>input (315 residues)
MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCY
QQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYL
LLQFAVAEFMDEPDFKRSCAVGFSGVLFALKVLNNHYCPGGFVNILGFPVPNRFACWVEL
VAIHLFSPGTSFAGHLAGILVGLMYTQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSS
GYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLS
PEEMRRQRLHRFDSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEB9	1.000	1.000	6.373E-49	315	1.000	1.000	Q8TEB9.pdb.gz	RHBL4_HUMAN Rhomboid-related protein 4 OS=Homo sapiens OX=9606 GN=RHBDD1 PE=1 SV=1
2	AFDB:Q8BHC7	0.760	0.760	4.346E-41	315	0.810	0.810	Q8BHC7.pdb.gz	RHBL4_MOUSE Rhomboid-related protein 4 OS=Mus musculus OX=10090 GN=Rhbdd1 PE=1 SV=1
3	AFDB:Q8RXW0	0.610	0.577	1.385E-13	334	0.321	0.302	Q8RXW0.pdb.gz	RBL14_ARATH Rhomboid-like protein 14, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBL14 PE=2 SV=1
4	AFDB:F4J5V3	0.581	0.436	5.752E-11	426	0.213	0.157	F4J5V3.pdb.gz	F4J5V3_ARATH RHOMBOID-like protein 15 OS=Arabidopsis thaliana OX=3702 GN=RBL15 PE=1 SV=1
5	AFDB:Q8VEK2	0.473	0.416	1.145E-8	361	0.190	0.166	Q8VEK2.pdb.gz	RHBD2_MOUSE Rhomboid domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rhbdd2 PE=1 SV=1
6	AFDB:O74926	0.503	0.612	2.389E-8	251	0.162	0.203	O74926.pdb.gz	RBD2_SCHPO Rhomboid-type serine protease 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rbd2 PE=1 SV=2
7	AFDB:Q6NTF9	0.484	0.424	1.092E-7	364	0.187	0.162	Q6NTF9.pdb.gz	RHBD2_HUMAN Rhomboid domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RHBDD2 PE=1 SV=2
8	AFDB:Q12270	0.496	0.586	1.395E-7	262	0.152	0.183	Q12270.pdb.gz	RBD2_YEAST Rhomboid-type serine protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBD2 PE=1 SV=1
9	AFDB:Q8LF05	0.483	0.499	2.770E-7	304	0.152	0.158	Q8LF05.pdb.gz	RBL19_ARATH Rhomboid-like protein 19 OS=Arabidopsis thaliana OX=3702 GN=RBL19 PE=2 SV=1
10	AFDB:Q8BP97	0.478	0.398	4.750E-7	385	0.194	0.158	Q8BP97.pdb.gz	RHBD3_MOUSE Rhomboid domain-containing protein 3 OS=Mus musculus OX=10090 GN=Rhbdd3 PE=2 SV=1
11	PDB:2nr9A	0.408	0.630	4.589E-5	192	0.140	0.229	2nr9A.pdb.gz	The crystal structure of the rhomboid peptidase from Haemophilus influenzae provides insight into intramembrane proteolysis.
12	PDB:6vk0C	0.321	0.487	8.710E-2	180	0.086	0.150	6vk0C.pdb.gz
13	PDB:5fn3B	0.129	0.138	1.570	286	0.092	0.101	5fn3B.pdb.gz	Sampling the conformational space of the catalytic subunit of human gamma-secretase.
14	PDB:6whgA	0.108	0.075	1.649	523	0.143	0.086	6whgA.pdb.gz	Structure of the ancient TRPY1 channel from Saccharomyces cerevisiae reveals mechanisms of modulation by lipids and calcium.
15	PDB:6idfB	0.150	0.152	1.819	312	0.108	0.109	6idfB.pdb.gz	Structural basis of Notch recognition by human gamma-secretase
16	PDB:7c7sA	0.179	0.110	1.819	685	0.095	0.044	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
17	PDB:7bylA	0.119	0.111	2.324	354	0.127	0.113	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
18	PDB:7vh5A	0.224	0.118	2.441	804	0.079	0.031	7vh5A.pdb.gz
19	PDB:4q25A	0.153	0.185	2.564	211	0.079	0.118	4q25A.pdb.gz
20	PDB:6jmqA	0.124	0.101	2.970	403	0.073	0.057	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BHC7	0.0	542	315	0.810	0.810	RHBL4_MOUSE Rhomboid-related protein 4 OS=Mus musculus OX=10090 GN=Rhbdd1 PE=1 SV=1
2	Q8TEB9	0.0	655	315	1.000	1.000	RHBL4_HUMAN Rhomboid-related protein 4 OS=Homo sapiens OX=9606 GN=RHBDD1 PE=1 SV=1
3	C9K011	2.81e-108	313	151	0.479	1.000	C9K011_HUMAN Rhomboid domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=RHBDD1 PE=1 SV=1
4	C9J1R4	3.69e-95	279	134	0.425	1.000	C9J1R4_HUMAN Rhomboid domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=RHBDD1 PE=4 SV=1
5	C9JQK8	1.55e-86	257	124	0.394	1.000	C9JQK8_HUMAN Rhomboid domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=RHBDD1 PE=4 SV=1
6	Q8RXW0	2.06e-30	119	334	0.232	0.219	RBL14_ARATH Rhomboid-like protein 14, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBL14 PE=2 SV=1
7	F4J5V3	5.55e-13	71.2	426	0.140	0.103	F4J5V3_ARATH RHOMBOID-like protein 15 OS=Arabidopsis thaliana OX=3702 GN=RBL15 PE=1 SV=1
8	Q12270	4.67e-04	43.5	262	0.130	0.156	RBD2_YEAST Rhomboid-type serine protease 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RBD2 PE=1 SV=1
9	Q8VEK2	0.001	42.7	361	0.140	0.122	RHBD2_MOUSE Rhomboid domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rhbdd2 PE=1 SV=1
10	Q6NTF9	0.009	39.7	364	0.133	0.115	RHBD2_HUMAN Rhomboid domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RHBDD2 PE=1 SV=2
11	Q9LYP1	0.013	39.3	346	0.102	0.092	RBL3_ARATH RHOMBOID-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=RBL3 PE=2 SV=1
12	P53259	0.064	37.0	346	0.187	0.171	PCP1_YEAST Rhomboid protein 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCP1 PE=1 SV=1
13	P44783	0.077	36.2	192	0.152	0.250	GLPG_HAEIN Rhomboid protease GlpG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=glpG PE=1 SV=1
14	F4JBM4	0.088	36.6	394	0.086	0.069	RBL4_ARATH RHOMBOID-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=RBL4 PE=2 SV=1
15	Q9CAN1	0.37	34.7	317	0.086	0.085	RBL2_ARATH RHOMBOID-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=RBL2 PE=1 SV=1
16	P46116	1.8	32.3	281	0.105	0.117	AARA_PROST Rhomboid protease AarA OS=Providencia stuartii OX=588 GN=aarA PE=1 SV=1
17	O35815	2.5	32.3	355	0.060	0.054	ATX3_RAT Ataxin-3 OS=Rattus norvegicus OX=10116 GN=Atxn3 PE=1 SV=1
18	Q9W0E9	2.6	32.3	485	0.156	0.101	Q9W0E9_DROME Stem cell tumor, isoform B OS=Drosophila melanogaster OX=7227 GN=stet PE=4 SV=2
19	A4QP06	2.7	32.3	699	0.057	0.026	A4QP06_DANRE U4/U6 small nuclear ribonucleoprotein Prp3 OS=Danio rerio OX=7955 GN=wu:fa11f05 PE=1 SV=1
20	Q90XW5	3.8	31.6	474	0.076	0.051	IRX5_XENLA Iroquois-class homeodomain protein irx-5 OS=Xenopus laevis OX=8355 GN=irx5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01694 Rhomboid	1.1e-18	79.1	Rhomboid family
2	PF02809 UIM	2.5e+02	12.9	Ubiquitin interaction motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375914

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351777	0.951	Transitional endoplasmic reticulum ATPase
2	9606.ENSP00000344206	0.809	Rhomboid-related protein 1
3	9606.ENSP00000216085	0.796	Rhomboid domain containing 3
4	9606.ENSP00000322775	0.782	Inactive rhomboid protein 2
5	9606.ENSP00000289248	0.756	Rhomboid-related protein 2
6	9606.ENSP00000319597	0.754	snRNA-activating protein complex subunit 5
7	9606.ENSP00000276569	0.752	Armadillo repeat containing 1
8	9606.ENSP00000267339	0.748	Ankyrin repeat domain-containing protein 10
9	9606.ENSP00000272907	0.733	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2
10	9606.ENSP00000484804	0.732	LisH domain-containing protein ARMC9
11	9606.ENSP00000300650	0.729	Ring finger protein 214
12	9606.ENSP00000429015	0.723	Ankyrin repeat domain-containing protein 46
13	9606.ENSP00000158762	0.714	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1
14	9606.ENSP00000261369	0.712	Sorting nexin-24
15	9606.ENSP00000006777	0.702	Rhomboid domain containing 2
16	9606.ENSP00000307833	0.698	F-box only protein 22
17	9606.ENSP00000416558	0.697	F-box only protein 24
18	9606.ENSP00000369897	0.691	Cysteine--tRNA ligase, cytoplasmic
19	9606.ENSP00000300179	0.679	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 1
20	9606.ENSP00000269051	0.675	Rhomboid-related protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004252	1.000	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050789	0.966	regulation of biological process
GO:0050794	0.958	regulation of cellular process
GO:0060255	0.956	regulation of macromolecule metabolic process
GO:0080090	0.950	regulation of primary metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0035966	0.950	response to topologically incorrect protein
GO:0071704	0.946	organic substance metabolic process
GO:0048519	0.944	negative regulation of biological process
GO:0048518	0.944	positive regulation of biological process
GO:0051246	0.939	regulation of protein metabolic process
GO:0051247	0.930	positive regulation of protein metabolic process
GO:0044238	0.929	primary metabolic process
GO:0051716	0.925	cellular response to stimulus
GO:0033619	0.923	membrane protein proteolysis
GO:0048523	0.920	negative regulation of cellular process
GO:0010941	0.911	regulation of cell death
GO:0060548	0.892	negative regulation of cell death
GO:0034620	0.868	cellular response to unfolded protein
GO:0042981	0.840	regulation of apoptotic process
GO:0032879	0.467	regulation of localization
GO:0043069	0.393	negative regulation of programmed cell death
GO:0043066	0.348	negative regulation of apoptotic process
GO:0009894	0.313	regulation of catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.906	membrane
GO:0031090	0.334	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.21.-	1.000	Serine endopeptidases.

[back to server]