StarFunc result for job id Q8TEC5

User Input

>input (729 residues)
MDDLTLLDLLECPVCFEKLDVTAKVLPCQHTFCKPCLQRVFKAHKELRCPECRTPVFSNI
EALPANLLLVRLLDGVRSGQSSGRGGSFRRPGTMTLQDGRKSRTNPRRLQASPFRLVPNV
RIHMDGVPRAKALCNYRGQNPGDLRFNKGDIILLRRQLDENWYQGEINGISGNFPASSVE
VIKQLPQPPPLCRALYNFDLRGKDKSENQDCLTFLKDDIITVISRVDENWAEGKLGDKVG
IFPILFVEPNLTARHLLEKNKGRQSSRTKNLSLVSSSSRGNTSTLRRGPGSRRKVPGQFS
ITTALNTLNRMVHSPSGRHMVEISTPVLISSSNPSVITQPMEKADVPSSCVGQVSTYHPA
PVSPGHSTAVVSLPGSQQHLSANMFVALHSYSAHGPDELDLQKGEGVRVLGKCQDGWLRG
VSLVTGRVGIFPNNYVIPIFRKTSSFPDSRSPGLYTTWTLSTSSVSSQGSISEGDPRQSR
PFKSVFVPTAIVNPVRSTAGPGTLGQGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRR
SPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSEAWIHSAASSL
IMEDKEIPIKSEPLPKPPASAPPSILVKPENSRNGIEKQVKTVRFQNYSPPPTKHYTSHP
TSGKPEQPATLKASQPEAASLGPEMTVLFAHRSGCHSGQQTDLRRKSALGKATTLVSTAS
GTQTVFPSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08AM8	0.355	0.355	0.000	729	0.997	0.997	Q08AM8.pdb.gz	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
2	AFDB:Q498M5	0.397	0.395	4.321E-91	735	0.819	0.812	Q498M5.pdb.gz	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
3	AFDB:Q6NRD3	0.180	0.160	2.649E-48	826	0.379	0.334	Q6NRD3.pdb.gz	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
4	AFDB:Q71F54	0.185	0.152	9.967E-46	894	0.366	0.299	Q71F54.pdb.gz	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1
5	AFDB:Q8TEJ3	0.197	0.164	1.370E-43	882	0.359	0.297	Q8TEJ3.pdb.gz	SH3R3_HUMAN E3 ubiquitin-protein ligase SH3RF3 OS=Homo sapiens OX=9606 GN=SH3RF3 PE=1 SV=2
6	AFDB:Q7K4D1	0.144	0.129	1.323E-39	838	0.280	0.243	Q7K4D1.pdb.gz	Q7K4D1_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=POSH PE=1 SV=1
7	AFDB:Q9VA36	0.116	0.101	3.157E-17	882	0.173	0.143	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
8	AFDB:P32790	0.085	0.051	1.989E-9	1244	0.155	0.091	P32790.pdb.gz	SLA1_YEAST Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLA1 PE=1 SV=1
9	PDB:1griA	0.078	0.256	1.391E-6	211	0.055	0.190	1griA.pdb.gz
10	PDB:2lqnA	0.081	0.179	1.946E-6	303	0.073	0.175	2lqnA.pdb.gz
11	AFDB:Q54DW4	0.078	0.043	4.742E-6	1350	0.147	0.079	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
12	PDB:2dybA	0.085	0.205	1.458E-5	298	0.043	0.104	2dybA.pdb.gz
13	PDB:2eyzA	0.112	0.216	5.280E-5	304	0.049	0.118	2eyzA.pdb.gz
14	PDB:2h8hA	0.076	0.123	8.261E-5	445	0.027	0.045	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	AFDB:A4FU49	0.082	0.093	9.728E-5	640	0.136	0.155	A4FU49.pdb.gz	SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens OX=9606 GN=SH3D21 PE=2 SV=2
16	PDB:6x5hA	0.077	0.120	3.957E-4	467	0.022	0.034	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
17	PDB:1k9aB	0.076	0.125	4.426E-4	441	0.021	0.034	1k9aB.pdb.gz
18	PDB:3ehqA	0.073	0.280	5.854E-4	182	0.025	0.099	3ehqA.pdb.gz
19	PDB:1k0xA	0.077	0.484	1.024E-3	108	0.023	0.157	1k0xA.pdb.gz
20	PDB:3qwyA	0.074	0.302	1.146E-3	170	0.027	0.118	3qwyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AM8	0.0	1481	729	0.997	0.997	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
2	Q498M5	0.0	1130	735	0.805	0.799	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
3	Q8TEC5	0.0	1487	729	1.000	1.000	SH3R2_HUMAN E3 ubiquitin-protein ligase SH3RF2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=3
4	Q6NRD3	8.72e-126	396	826	0.324	0.286	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
5	Q8TEJ3	5.76e-113	364	882	0.284	0.235	SH3R3_HUMAN E3 ubiquitin-protein ligase SH3RF3 OS=Homo sapiens OX=9606 GN=SH3RF3 PE=1 SV=2
6	Q69ZI1	1.70e-96	320	892	0.236	0.193	SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus OX=10090 GN=Sh3rf1 PE=1 SV=2
7	Q71F54	1.77e-96	320	894	0.241	0.197	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1
8	Q7Z6J0	9.43e-96	318	888	0.241	0.198	SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens OX=9606 GN=SH3RF1 PE=1 SV=2
9	Q9NHP2	5.83e-56	207	838	0.152	0.132	Q9NHP2_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=POSH PE=1 SV=1
10	Q7K4D1	6.42e-56	207	838	0.152	0.132	Q7K4D1_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=POSH PE=1 SV=1
11	Q966U7	5.51e-32	129	313	0.132	0.307	Q966U7_DROME CAP, isoform E OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
12	Q8IGB7	1.24e-31	128	350	0.132	0.274	Q8IGB7_DROME RH64582p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
13	D3DMM3	5.77e-31	130	554	0.132	0.173	D3DMM3_DROME CAP, isoform S OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
14	Q7K1M7	6.59e-31	129	500	0.132	0.192	Q7K1M7_DROME CAP, isoform G OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
15	A1Z871	9.59e-31	132	1734	0.132	0.055	A1Z871_DROME CAP, isoform B OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
16	A1Z870	9.67e-31	130	565	0.132	0.170	A1Z870_DROME CAP, isoform J OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
17	Q966V0	9.86e-31	132	1743	0.132	0.055	Q966V0_DROME CAP, isoform R OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
18	B7YZD9	1.06e-30	132	2365	0.134	0.041	B7YZD9_DROME CAP, isoform L OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
19	A0A0B4K7L3	1.21e-30	132	2505	0.134	0.039	A0A0B4K7L3_DROME CAP, isoform X OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
20	B7YZD8	1.22e-30	132	2412	0.134	0.041	B7YZD8_DROME CAP, isoform Q OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12773 DZR	3.8e+02	12.5	Double zinc ribbon
2	PF14447 Prok-RING_4	1.6e+02	13.6	Prokaryotic RING finger family 4
3	PF00018 SH3_1	5.9e-27	104.4	SH3 domain
4	PF07653 SH3_2	1.8e-28	109.4	Variant SH3 domain
5	PF14604 SH3_9	1.3e-27	106.8	Variant SH3 domain
6	PF00097 zf-C3HC4	4.7e-05	34.5	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	3.2e-05	35.0	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.00012	33.1	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	25	16.4	zinc finger of C3HC4-type, RING
10	PF13639 zf-RING_2	7.3e-05	34.4	Ring finger domain
11	PF14570 zf-RING_4	0.45	21.6	RING/Ubox like zinc-binding domain
12	PF14634 zf-RING_5	0.0018	29.5	zinc-RING finger domain
13	PF14835 zf-RING_6	1.6e+02	13.5	zf-RING of BARD1-type protein
14	PF13445 zf-RING_UBOX	1.5e-05	36.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424497

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441235	0.735	Thyrotropin receptor
2	9606.ENSP00000430955	0.718	E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. In response to bacterial infection, negatively regulates the phagocyte oxidative burst by controlling the turnover of the NADPH oxidase complex subunits. Promotes monoubiquitination of CYBA and 'Lys-48'- linked polyubiquitination and degradation of CYBB NADPH oxidase catalytic subunits, both essential for the generation of antimicrobial reactive oxygen species. Involved in the maintenance of cholesterol homeostasis. In response to high sterol concentrations [...]
3	9606.ENSP00000376258	0.714	E3 ubiquitin-protein ligase RNF34
4	9606.ENSP00000437464	0.710	F-box/LRR-repeat protein 17
5	9606.ENSP00000280236	0.686	Fibrous sheath interacting protein 1
6	9606.ENSP00000326031	0.684	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
7	9606.ENSP00000269391	0.636	E3 ubiquitin ligase RNF157
8	9606.ENSP00000259939	0.630	E3 ubiquitin-protein ligase RNF144B
9	9606.ENSP00000469413	0.629	Serine/threonine-protein kinase PAK 4
10	9606.ENSP00000301532	0.627	Olfactory receptor 5I1
11	9606.ENSP00000423673	0.622	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
12	9606.ENSP00000481249	0.612	Suppressor of cytokine signaling 2
13	9606.ENSP00000356301	0.604	Transmembrane protein 9
14	9606.ENSP00000308695	0.603	Probable C-mannosyltransferase DPY19L1
15	9606.ENSP00000359540	0.603	Protein CREG1
16	9606.ENSP00000217740	0.591	E3 ubiquitin-protein ligase RNF125
17	9606.ENSP00000311184	0.590	WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2
18	9606.ENSP00000366058	0.579	Synapse differentiation-inducing gene protein 1
19	9606.ENSP00000265271	0.557	RNA-binding protein 27
20	9606.ENSP00000351813	0.542	E3 ubiquitin-protein ligase MARCH5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140096	0.842	catalytic activity, acting on a protein
GO:0004842	0.818	ubiquitin-protein transferase activity
GO:0061630	0.712	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.979	regulation of cellular process
GO:0008152	0.962	metabolic process
GO:0071704	0.951	organic substance metabolic process
GO:0044238	0.941	primary metabolic process
GO:0019222	0.937	regulation of metabolic process
GO:0060255	0.934	regulation of macromolecule metabolic process
GO:0048522	0.929	positive regulation of cellular process
GO:0080090	0.928	regulation of primary metabolic process
GO:0051171	0.928	regulation of nitrogen compound metabolic process
GO:0023051	0.921	regulation of signaling
GO:0010646	0.921	regulation of cell communication
GO:0051246	0.914	regulation of protein metabolic process
GO:0043170	0.911	macromolecule metabolic process
GO:0048583	0.909	regulation of response to stimulus
GO:0006807	0.902	nitrogen compound metabolic process
GO:0043410	0.888	positive regulation of MAPK cascade
GO:0048523	0.886	negative regulation of cellular process
GO:0031323	0.872	regulation of cellular metabolic process
GO:0045732	0.868	positive regulation of protein catabolic process
GO:0032874	0.860	positive regulation of stress-activated MAPK cascade
GO:0061136	0.859	regulation of proteasomal protein catabolic process
GO:0032446	0.850	protein modification by small protein conjugation
GO:0032434	0.840	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:2000060	0.835	positive regulation of ubiquitin-dependent protein catabolic process
GO:1901800	0.834	positive regulation of proteasomal protein catabolic process
GO:0043067	0.821	regulation of programmed cell death
GO:0060548	0.821	negative regulation of cell death
GO:0042981	0.742	regulation of apoptotic process
GO:0016567	0.686	protein ubiquitination
GO:0009987	0.662	cellular process
GO:0032436	0.614	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043069	0.576	negative regulation of programmed cell death
GO:0046328	0.574	regulation of JNK cascade
GO:0043066	0.549	negative regulation of apoptotic process
GO:0051865	0.466	protein autoubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005654	0.990	nucleoplasm
GO:0005737	0.828	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.818	Transferases.

[back to server]