StarFunc result for job id Q8TED0

User Input

>input (518 residues)
MAGYKPVAIQTYPILGEKITQDTLYWNNYKTPVQIKEFGAVSKVDFSPQPPYNYAVTASS
RIHIYGRYSQEPIKTFSRFKDTAYCATFRQDGRLLVAGSEDGGVQLFDISGRAPLRQFEG
HTKAVHTVDFTADKYHVVSGADDYTVKLWDIPNSKEILTFKEHSDYVRCGCASKLNPDLF
ITGSYDHTVKMFDARTSESVLSVEHGQPVESVLLFPSGGLLVSAGGRYVKVWDMLKGGQL
LVSLKNHHKTVTCLCLSSSGQRLLSGSLDRKVKVYSTTSYKVVHSFDYAASILSLALAHE
DETIVVGMTNGILSVKHRKSEAKKESLPRRRRPAYRTFIKGKNYMKQRDDILINRPAKKH
LELYDRDLKHFRISKALDRVLDPTCTIKTPEITVSIIKELNRRGVLANALAGRDEKEISH
VLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSPVVDKKFLLLQGLVEKEIDYQREL
LETLGMMDMLFATMRRKEGTSVLEHTSDGFPENKKIES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TED0	1.000	1.000	1.107E-94	518	1.000	1.000	Q8TED0.pdb.gz	UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=3
2	PDB:7mq8LJ	0.746	0.815	5.145E-74	469	0.902	0.996	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
3	AFDB:Q7ZW33	0.765	0.767	2.996E-69	517	0.566	0.567	Q7ZW33.pdb.gz	UTP15_DANRE U3 small nucleolar RNA-associated protein 15 homolog OS=Danio rerio OX=7955 GN=utp15 PE=2 SV=1
4	AFDB:O94365	0.668	0.695	1.102E-50	494	0.336	0.352	O94365.pdb.gz	UTP15_SCHPO U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp15 PE=3 SV=1
5	AFDB:O82266	0.694	0.681	1.570E-47	530	0.332	0.325	O82266.pdb.gz	SWA1_ARATH Protein SLOW WALKER 1 OS=Arabidopsis thaliana OX=3702 GN=SWA1 PE=2 SV=1
6	AFDB:Q04305	0.690	0.695	8.856E-45	513	0.292	0.294	Q04305.pdb.gz	UTP15_YEAST U3 small nucleolar RNA-associated protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP15 PE=1 SV=1
7	PDB:7ajtUO	0.681	0.710	4.924E-36	493	0.282	0.296	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
8	AFDB:Q59Y40	0.592	0.720	2.151E-33	423	0.228	0.279	Q59Y40.pdb.gz	Q59Y40_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTP15 PE=4 SV=1
9	AFDB:Q581Y4	0.730	0.787	3.084E-33	477	0.234	0.254	Q581Y4.pdb.gz	Q581Y4_TRYB2 U3 small nucleolar RNA-associated protein 15 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.450 PE=4 SV=1
10	AFDB:Q5U3Q5	0.542	0.329	7.816E-26	897	0.197	0.114	Q5U3Q5.pdb.gz	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
11	AFDB:Q9LFE2	0.560	0.347	1.180E-25	876	0.158	0.094	Q9LFE2.pdb.gz	TOZ_ARATH Protein TORMOZ EMBRYO DEFECTIVE OS=Arabidopsis thaliana OX=3702 GN=TOZ PE=1 SV=1
12	AFDB:Q12788	0.568	0.384	3.858E-25	808	0.160	0.103	Q12788.pdb.gz	TBL3_HUMAN Transducin beta-like protein 3 OS=Homo sapiens OX=9606 GN=TBL3 PE=1 SV=2
13	PDB:7mqaLQ	0.503	0.319	7.254E-24	830	0.187	0.117	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7d5sB2	0.495	0.306	1.298E-22	851	0.181	0.110	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	PDB:5mzhB	0.483	0.594	1.679E-22	415	0.098	0.123	5mzhB.pdb.gz
16	PDB:7mq8LR	0.517	0.357	2.535E-22	773	0.162	0.109	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:5nnzA	0.493	0.737	3.279E-22	335	0.120	0.185	5nnzA.pdb.gz
18	PDB:2h9lA	0.522	0.829	5.213E-22	321	0.149	0.240	2h9lA.pdb.gz
19	PDB:7ajuUL	0.497	0.335	3.691E-21	779	0.170	0.113	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:4v6wAg	0.531	0.851	2.126E-20	318	0.143	0.233	4v6wAg.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y8P4	0.0	1009	545	0.948	0.901	H0Y8P4_HUMAN U3 small nucleolar RNA-associated protein 15 homolog (Fragment) OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=1
2	Q7ZW33	0.0	638	517	0.573	0.574	UTP15_DANRE U3 small nucleolar RNA-associated protein 15 homolog OS=Danio rerio OX=7955 GN=utp15 PE=2 SV=1
3	Q8TED0	0.0	1073	518	1.000	1.000	UTP15_HUMAN U3 small nucleolar RNA-associated protein 15 homolog OS=Homo sapiens OX=9606 GN=UTP15 PE=1 SV=3
4	O94365	8.87e-103	319	494	0.346	0.362	UTP15_SCHPO U3 small nucleolar RNA-associated protein 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=utp15 PE=3 SV=1
5	Q04305	4.47e-77	253	513	0.309	0.312	UTP15_YEAST U3 small nucleolar RNA-associated protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP15 PE=1 SV=1
6	O82266	4.03e-76	251	530	0.324	0.317	SWA1_ARATH Protein SLOW WALKER 1 OS=Arabidopsis thaliana OX=3702 GN=SWA1 PE=2 SV=1
7	Q59Y40	2.82e-53	187	423	0.228	0.279	Q59Y40_CANAL SnoRNA-binding rRNA-processing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UTP15 PE=4 SV=1
8	Q581Y4	2.18e-42	159	477	0.268	0.291	Q581Y4_TRYB2 U3 small nucleolar RNA-associated protein 15 C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.450 PE=4 SV=1
9	Q8JZX3	5.10e-27	115	405	0.149	0.190	POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus OX=10090 GN=Poc1a PE=2 SV=2
10	Q8NBT0	3.64e-26	112	407	0.151	0.192	POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens OX=9606 GN=POC1A PE=1 SV=2
11	O22826	6.46e-25	107	343	0.135	0.204	O22826_ARATH At2g43770 OS=Arabidopsis thaliana OX=3702 GN=At2g43770 PE=1 SV=1
12	Q9V3J8	5.17e-24	105	361	0.149	0.213	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
13	Q7ZTX2	1.39e-23	103	334	0.145	0.225	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
14	P61964	2.20e-23	103	334	0.145	0.225	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
15	P61965	2.20e-23	103	334	0.145	0.225	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
16	Q498M4	2.20e-23	103	334	0.145	0.225	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
17	Q54KL5	2.35e-22	100	335	0.125	0.194	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
18	Q4V8C4	2.46e-22	100	328	0.141	0.223	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
19	A0MNP2	6.09e-22	99.4	357	0.118	0.171	A0MNP2_HUMAN CDW11/WDR57 OS=Homo sapiens OX=9606 GN=WDR57 PE=2 SV=1
20	Q96DI7	6.09e-22	99.4	357	0.118	0.171	SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	2.5e-07	42.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF14783 BBS2_Mid	0.3	22.6	Ciliary BBSome complex subunit 2, middle region
3	PF20426 NBCH_WD40	6.1e-08	43.5	Neurobeachin beta propeller domain
4	PF13570 PQQ_3	2.5e+02	13.6	PQQ-like domain
5	PF09384 UTP15_C	2.7e-45	165.1	UTP15 C terminal
6	PF00400 WD40	4.7e-25	98.6	WD domain, G-beta repeat
7	PF17005 WD40_like	13	16.6	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296792

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225298	0.999	U3 small nucleolar RNA-associated protein 18 homolog
2	9606.ENSP00000244230	0.999	U3 small nucleolar ribonucleoprotein protein MPP10
3	9606.ENSP00000261708	0.999	U3 small nucleolar RNA-associated protein 6 homolog
4	9606.ENSP00000264279	0.999	Nucleolar protein 58
5	9606.ENSP00000314193	0.999	WD repeat-containing protein 75
6	9606.ENSP00000327179	0.999	U3 small nucleolar RNA-associated protein 4 homolog
7	9606.ENSP00000355541	0.999	HEAT repeat-containing protein 1
8	9606.ENSP00000363746	0.999	WD repeat-containing protein 46
9	9606.ENSP00000384302	0.999	WD repeat-containing protein 43
10	9606.ENSP00000423067	0.999	WD repeat-containing protein 36
11	9606.ENSP00000328854	0.998	Nucleolar complex protein 4 homolog
12	9606.ENSP00000454836	0.998	Transducin beta-like protein 3
13	9606.ENSP00000232888	0.997	U3 small nucleolar RNA-interacting protein 2
14	9606.ENSP00000297579	0.997	DDB1- and CUL4-associated factor 13
15	9606.ENSP00000363642	0.997	Ribosome biogenesis protein BMS1 homolog
16	9606.ENSP00000405068	0.997	Nucleolar protein 14
17	9606.ENSP00000221801	0.996	rRNA 2'-O-methyltransferase fibrillarin
18	9606.ENSP00000230340	0.996	Bystin
19	9606.ENSP00000308179	0.996	WD repeat-containing protein 3
20	9606.ENSP00000370589	0.996	Nucleolar protein 56

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050789	0.987	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0048518	0.941	positive regulation of biological process
GO:0009987	0.798	cellular process
GO:0019222	0.793	regulation of metabolic process
GO:0060255	0.771	regulation of macromolecule metabolic process
GO:0080090	0.763	regulation of primary metabolic process
GO:0031323	0.763	regulation of cellular metabolic process
GO:0051173	0.762	positive regulation of nitrogen compound metabolic process
GO:0010468	0.752	regulation of gene expression
GO:0009889	0.746	regulation of biosynthetic process
GO:0031326	0.744	regulation of cellular biosynthetic process
GO:0010556	0.734	regulation of macromolecule biosynthetic process
GO:0019219	0.714	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.710	positive regulation of macromolecule metabolic process
GO:0048522	0.708	positive regulation of cellular process
GO:0031325	0.699	positive regulation of cellular metabolic process
GO:0051252	0.697	regulation of RNA metabolic process
GO:0006356	0.679	regulation of transcription by RNA polymerase I
GO:0009891	0.676	positive regulation of biosynthetic process
GO:0045943	0.668	positive regulation of transcription by RNA polymerase I
GO:0008152	0.538	metabolic process
GO:0071704	0.530	organic substance metabolic process
GO:0044237	0.496	cellular metabolic process
GO:0044238	0.493	primary metabolic process
GO:0006807	0.404	nitrogen compound metabolic process
GO:0043170	0.377	macromolecule metabolic process
GO:0034641	0.316	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005737	0.999	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0012505	0.922	endomembrane system
GO:0005783	0.790	endoplasmic reticulum
GO:0001650	0.479	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]