StarFunc result for job id Q8TED4

User Input

>input (501 residues)
MRSSLAPGVWFFRAFSRDSWFRGLILLLTFLIYACYHMSRKPISIVKSRLHQNCSEQIKP
INDTHSLNDTMWCSWAPFDKDNYKELLGGVDNAFLIAYAIGMFISGVFGERLPLRYYLSA
GMLLSGLFTSLFGLGYFWNIHELWYFVVIQVCNGLVQTTGWPSVVTCVGNWFGKGKRGFI
MGIWNSHTSVGNILGSLIAGIWVNGQWGLSFIVPGIITAVMGVITFLFLIEHPEDVDCAP
PQHHGEPAENQDNPEDPGNSPCSIRESGLETVAKCSKGPCEEPAAISFFGALRIPGVVEF
SLCLLFAKLVSYTFLYWLPLYIANVAHFSAKEAGDLSTLFDVGGIIGGIVAGLVSDYTNG
RATTCCVMLILAAPMMFLYNYIGQDGIASSIVMLIICGGLVNGPYALITTAVSADLGTHK
SLKGNAKALSTVTAIIDGTGSIGAALGPLLAGLISPTGWNNVFYMLISADVLACLLLCRL
VYKEILAWKVSLSRGSGYKEI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TED4	1.000	1.000	2.282E-67	501	1.000	1.000	Q8TED4.pdb.gz	G6PT3_HUMAN Glucose-6-phosphate exchanger SLC37A2 OS=Homo sapiens OX=9606 GN=SLC37A2 PE=2 SV=2
2	AFDB:Q7SY29	0.959	0.972	1.103E-52	494	0.695	0.704	Q7SY29.pdb.gz	G6PT3_DANRE Glucose-6-phosphate exchanger SLC37A2 OS=Danio rerio OX=7955 GN=slc37a2 PE=2 SV=1
3	AFDB:P57057	0.852	0.802	1.820E-44	533	0.601	0.565	P57057.pdb.gz	G6PT2_HUMAN Glucose-6-phosphate exchanger SLC37A1 OS=Homo sapiens OX=9606 GN=SLC37A1 PE=2 SV=2
4	AFDB:Q9C5L3	0.818	0.785	8.394E-36	523	0.471	0.451	Q9C5L3.pdb.gz	GLPT1_ARATH Putative glycerol-3-phosphate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=At3g47420 PE=2 SV=1
5	AFDB:O23596	0.786	0.725	1.121E-34	544	0.491	0.452	O23596.pdb.gz	GLPT4_ARATH Putative glycerol-3-phosphate transporter 4 OS=Arabidopsis thaliana OX=3702 GN=At4g17550 PE=3 SV=2
6	AFDB:Q9SL56	0.835	0.848	1.376E-34	493	0.459	0.467	Q9SL56.pdb.gz	GLPT5_ARATH Putative glycerol-3-phosphate transporter 5 OS=Arabidopsis thaliana OX=3702 GN=At2g13100 PE=2 SV=2
7	AFDB:Q9SB41	0.818	0.813	1.837E-33	504	0.423	0.421	Q9SB41.pdb.gz	GLPT2_ARATH Putative glycerol-3-phosphate transporter 2 OS=Arabidopsis thaliana OX=3702 GN=At4g25220 PE=2 SV=1
8	AFDB:Q9SA71	0.782	0.769	9.138E-33	510	0.421	0.414	Q9SA71.pdb.gz	GLPT3_ARATH Putative glycerol-3-phosphate transporter 3 OS=Arabidopsis thaliana OX=3702 GN=At1g30560 PE=3 SV=1
9	AFDB:Q8NCC5	0.842	0.853	9.564E-28	494	0.327	0.332	Q8NCC5.pdb.gz	SPX3_HUMAN Sugar phosphate exchanger 3 OS=Homo sapiens OX=9606 GN=SLC37A3 PE=1 SV=2
10	AFDB:H2FLL7	0.791	0.851	8.134E-25	465	0.287	0.310	H2FLL7.pdb.gz	H2FLL7_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
11	PDB:1pw4A	0.632	0.717	6.536E-13	434	0.204	0.235	1pw4A.pdb.gz
12	PDB:3o7qA	0.518	0.607	3.846E-8	414	0.124	0.150	3o7qA.pdb.gz
13	PDB:7sptA	0.534	0.562	5.344E-8	470	0.134	0.143	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
14	PDB:7bc7A	0.587	0.668	6.300E-8	432	0.112	0.130	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
15	PDB:4gbyA	0.582	0.610	1.121E-7	475	0.132	0.139	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7bp3A	0.598	0.737	1.121E-7	394	0.128	0.162	7bp3A.pdb.gz
17	PDB:7zh0A	0.592	0.598	1.836E-7	495	0.142	0.143	7zh0A.pdb.gz
18	PDB:6kkkA	0.582	0.741	2.255E-7	381	0.122	0.160	6kkkA.pdb.gz
19	PDB:6thaA	0.534	0.587	2.255E-7	448	0.136	0.152	6thaA.pdb.gz
20	PDB:7oixB	0.558	0.611	2.448E-7	451	0.142	0.157	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P57057	0.0	572	533	0.613	0.576	G6PT2_HUMAN Glucose-6-phosphate exchanger SLC37A1 OS=Homo sapiens OX=9606 GN=SLC37A1 PE=2 SV=2
2	Q7SY29	0.0	714	494	0.711	0.721	G6PT3_DANRE Glucose-6-phosphate exchanger SLC37A2 OS=Danio rerio OX=7955 GN=slc37a2 PE=2 SV=1
3	Q8TED4	0.0	1019	501	1.000	1.000	G6PT3_HUMAN Glucose-6-phosphate exchanger SLC37A2 OS=Homo sapiens OX=9606 GN=SLC37A2 PE=2 SV=2
4	O23596	8.42e-146	431	544	0.481	0.443	GLPT4_ARATH Putative glycerol-3-phosphate transporter 4 OS=Arabidopsis thaliana OX=3702 GN=At4g17550 PE=3 SV=2
5	Q9C5L3	1.81e-139	414	523	0.471	0.451	GLPT1_ARATH Putative glycerol-3-phosphate transporter 1 OS=Arabidopsis thaliana OX=3702 GN=At3g47420 PE=2 SV=1
6	Q9SA71	2.67e-137	407	510	0.431	0.424	GLPT3_ARATH Putative glycerol-3-phosphate transporter 3 OS=Arabidopsis thaliana OX=3702 GN=At1g30560 PE=3 SV=1
7	Q9SL56	2.00e-133	397	493	0.453	0.460	GLPT5_ARATH Putative glycerol-3-phosphate transporter 5 OS=Arabidopsis thaliana OX=3702 GN=At2g13100 PE=2 SV=2
8	Q9SB41	2.90e-131	392	504	0.433	0.431	GLPT2_ARATH Putative glycerol-3-phosphate transporter 2 OS=Arabidopsis thaliana OX=3702 GN=At4g25220 PE=2 SV=1
9	Q8NCC5	3.66e-81	263	494	0.343	0.348	SPX3_HUMAN Sugar phosphate exchanger 3 OS=Homo sapiens OX=9606 GN=SLC37A3 PE=1 SV=2
10	H2FLL9	1.72e-66	223	461	0.301	0.328	H2FLL9_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
11	H2FLL7	1.84e-66	223	465	0.295	0.318	H2FLL7_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
12	H2FLL6	1.10e-65	221	452	0.291	0.323	H2FLL6_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
13	O62376	1.39e-65	221	456	0.291	0.320	O62376_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
14	H2FLL8	5.65e-61	207	396	0.255	0.323	H2FLL8_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
15	Q9U372	5.36e-60	204	387	0.251	0.326	Q9U372_CAEEL Major facilitator superfamily (MFS) profile domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10C6.6 PE=1 SV=1
16	P08194	1.55e-17	87.4	452	0.210	0.232	GLPT_ECOLI Glycerol-3-phosphate transporter OS=Escherichia coli (strain K12) OX=83333 GN=glpT PE=1 SV=1
17	P09836	3.32e-17	86.3	439	0.236	0.269	UHPC_ECOLI Membrane sensor protein UhpC OS=Escherichia coli (strain K12) OX=83333 GN=uhpC PE=1 SV=3
18	O43826	7.13e-12	69.7	429	0.160	0.186	G6PT1_HUMAN Glucose-6-phosphate exchanger SLC37A4 OS=Homo sapiens OX=9606 GN=SLC37A4 PE=1 SV=1
19	Q9VKC9	9.70e-12	69.3	496	0.204	0.206	Q9VKC9_DROME Dietary and metabolic glutamate transporter OS=Drosophila melanogaster OX=7227 GN=dmGlut PE=2 SV=2
20	Q6NY67	5.46e-10	63.5	429	0.150	0.175	Q6NY67_DANRE Glucose-6-phosphate translocase OS=Danio rerio OX=7955 GN=slc37a4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07690 MFS_1	9.2e-39	145.0	Major Facilitator Superfamily
2	PF12832 MFS_1_like	0.52	20.7	MFS_1 like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311833

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359376	0.719	Solute carrier family 17 member 9
2	9606.ENSP00000256969	0.653	Spexin
3	9606.ENSP00000235345	0.642	UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
4	9606.ENSP00000227880	0.562	Solute carrier family 15 member 3
5	9606.ENSP00000249041	0.553	Galanin receptor type 3
6	9606.ENSP00000356903	0.553	UDP-N-acetylhexosamine pyrophosphorylase
7	9606.ENSP00000386935	0.553	UDP-N-acetylhexosamine pyrophosphorylase-like protein 1
8	9606.ENSP00000329684	0.551	Galanin receptor type 2
9	9606.ENSP00000369816	0.542	Sex hormone-binding globulin
10	9606.ENSP00000272542	0.511	Sodium-dependent phosphate transporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901505	1.000	carbohydrate derivative transmembrane transporter activity
GO:0015605	1.000	organophosphate ester transmembrane transporter activity
GO:0015114	1.000	phosphate ion transmembrane transporter activity
GO:0005452	1.000	solute:inorganic anion antiporter activity
GO:0005488	0.972	binding
GO:0005515	0.964	protein binding
GO:0015315	0.939	organophosphate:inorganic phosphate antiporter activity
GO:0015152	0.923	glucose-6-phosphate transmembrane transporter activity
GO:0008514	0.836	organic anion transmembrane transporter activity
GO:0015526	0.796	hexose-phosphate:inorganic phosphate antiporter activity
GO:0015075	0.738	monoatomic ion transmembrane transporter activity
GO:0061513	0.729	glucose 6-phosphate:inorganic phosphate antiporter activity
GO:0008324	0.624	monoatomic cation transmembrane transporter activity
GO:0022890	0.572	inorganic cation transmembrane transporter activity
GO:0022853	0.548	active monoatomic ion transmembrane transporter activity
GO:0015293	0.407	symporter activity
GO:0015294	0.393	solute:monoatomic cation symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006810	0.979	transport
GO:0055085	0.968	transmembrane transport
GO:0071702	0.961	organic substance transport
GO:0015698	0.905	inorganic anion transport
GO:1901264	0.885	carbohydrate derivative transport
GO:0015748	0.763	organophosphate ester transport
GO:0006817	0.762	phosphate ion transport
GO:0098661	0.561	inorganic anion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0031090	0.991	organelle membrane
GO:0031984	0.984	organelle subcompartment
GO:0005783	0.983	endoplasmic reticulum
GO:0098827	0.943	endoplasmic reticulum subcompartment
GO:0005576	0.939	extracellular region
GO:0005789	0.871	endoplasmic reticulum membrane
GO:0031982	0.850	vesicle
GO:0005615	0.838	extracellular space
GO:0071944	0.559	cell periphery
GO:0065010	0.555	extracellular membrane-bounded organelle
GO:1903561	0.535	extracellular vesicle
GO:0070062	0.523	extracellular exosome
GO:0005886	0.470	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32823	1.000	phosphate(in) = phosphate(out)

[back to server]