StarFunc result for job id Q8TEK3

User Input

>input (1537 residues)
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGP
EGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMNTA
NPERKPKKNQTALDALHAQTVSQTAASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPT
PPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNAQLLGAAQQLLSHCQAQK
EEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLL
KARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMNGQAAGY
ELCGVLSRPSSKQNTPQYLASPLDQEVVPCTPSHVGRPRLEKLSGLAAPDYTRLSPAKIV
LRRHLSQDHTVPGRPAASELHSRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQL
AGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARST
PSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGA
EPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGAAQGPL
PEASKGDLPSDSGFSDPESEAKRRIVFTITTGAGSAKQSPSSKHSPLTASARGDCVPSHG
QDSRRRGRRKRASAGTPSLSAGVSPKRRALPSVAGLFTQPSGSPLNLNSMVSNINQPLEI
TAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDEPSSARI
ERKIATISLESKSPPKTLENGGGLAGRKPAPAGEPVNSSKWKSTFSPISDIGLAKSADSP
LQASSALSQNSLFTFRPALEEPSADAKLAAHPRKGFPGSLSGADGLSPGTNPANGCTFGG
GLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEGSDANPFLSKRQLDGLAGLK
GEGSRGKEAGEGGLPLCGPTDKTPLLSGKAAKARDREVDLKNGHNLFISAAAVPPGSLLS
GPGLAPAASSAGGAASSAQTHRSFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSS
VPAAAGLVHVSSAATRLTNSHAMGSFSGVAGGTVGGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6XZL8	0.280	0.280	0.000	1540	0.845	0.843	Q6XZL8.pdb.gz	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
2	AFDB:Q8TEK3	1.000	1.000	0.000	1537	1.000	1.000	Q8TEK3.pdb.gz	DOT1L_HUMAN Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Homo sapiens OX=9606 GN=DOT1L PE=1 SV=3
3	AFDB:Q5YL88	0.107	0.132	1.632E-97	1205	0.571	0.729	Q5YL88.pdb.gz	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
4	AFDB:A8E7B7	0.217	0.296	4.570E-93	1122	0.446	0.611	A8E7B7.pdb.gz
5	AFDB:F1Q4W7	0.186	0.196	1.859E-86	1454	0.455	0.481	F1Q4W7.pdb.gz	F1Q4W7_DANRE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Danio rerio OX=7955 GN=dot1l PE=1 SV=2
6	PDB:5jwjA	0.088	0.679	1.163E-8	162	0.023	0.222	5jwjA.pdb.gz
7	AFDB:F4I1T7	0.045	0.039	7.859E-8	1819	0.149	0.126	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
8	PDB:3v97A	0.091	0.192	8.912E-8	667	0.034	0.079	3v97A.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
9	PDB:3fpjB	0.088	0.418	9.431E-8	265	0.027	0.155	3fpjB.pdb.gz	Crystallographic snapshots of iterative substrate translocations during nicotianamine synthesis in Archaea
10	PDB:1qzzA	0.088	0.335	6.101E-7	340	0.031	0.141	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
11	PDB:7cfeA	0.102	0.583	6.831E-7	214	0.021	0.154	7cfeA.pdb.gz	Crystal structure of RsmG methyltransferase of M. tuberculosis
12	PDB:3v97B	0.090	0.200	1.015E-6	641	0.023	0.055	3v97B.pdb.gz	Structure of the bifunctional methyltransferase YcbY (RlmKL) that adds the m7G2069 and m2G2445 modifications in Escherichia coli 23S rRNA
13	PDB:2y7hB	0.099	0.253	1.347E-6	529	0.023	0.068	2y7hB.pdb.gz	The Structure of M.Ecoki Type I DNA Methyltransferase with a DNA Mimic Antirestriction Protein.
14	PDB:5mgzA	0.090	0.493	1.787E-6	230	0.025	0.165	5mgzA.pdb.gz	Structural and Functional Basis of C-Methylation of Coumarin Scaffolds by NovO.
15	PDB:1sqfA	0.090	0.278	2.118E-6	425	0.028	0.101	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
16	PDB:2ip2A	0.092	0.317	4.419E-6	330	0.029	0.136	2ip2A.pdb.gz
17	AFDB:A0A1D8PF53	0.058	0.063	1.603E-5	1296	0.118	0.140	A0A1D8PF53.pdb.gz	A0A1D8PF53_CANAL Cta3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CTA3 PE=4 SV=1
18	AFDB:Q1G7G9	0.052	0.053	1.697E-5	1523	0.126	0.127	Q1G7G9.pdb.gz	TALD3_CHICK TALPID3 protein OS=Gallus gallus OX=9031 GN=TALPID3 PE=2 SV=2
19	AFDB:Q80U93	0.044	0.035	2.382E-5	2085	0.152	0.112	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
20	AFDB:P35658	0.044	0.036	2.521E-5	2090	0.168	0.123	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6SJX8	0.0	568	424	0.215	0.778	F6SJX8_MOUSE DOT1-like, histone H3 methyltransferase (S. cerevisiae) (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
2	F7CVL0	0.0	1572	1202	0.550	0.703	F7CVL0_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
3	H9LAN6	0.0	2436	1736	0.836	0.740	H9LAN6_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
4	Q5YL88	0.0	1579	1205	0.552	0.704	Q5YL88_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
5	Q679P5	0.0	1803	1114	0.619	0.854	Q679P5_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
6	Q6XZL7	0.0	811	624	0.310	0.763	Q6XZL7_MOUSE Histone H3 methyltransferase DOT1 variant a (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
7	Q6XZL8	0.0	2459	1540	0.843	0.842	Q6XZL8_MOUSE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
8	Q8TEK3	0.0	3113	1537	1.000	1.000	DOT1L_HUMAN Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Homo sapiens OX=9606 GN=DOT1L PE=1 SV=3
9	Q8INR6	1.37e-116	408	1848	0.124	0.103	DOT1L_DROME Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Drosophila melanogaster OX=7227 GN=gpp PE=1 SV=2
10	Q6AW06	6.87e-41	167	946	0.068	0.110	DOT11_CAEEL Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Caenorhabditis elegans OX=6239 GN=dot-1.1 PE=1 SV=2
11	F1Q4W7	9.15e-30	131	1454	0.057	0.060	F1Q4W7_DANRE Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Danio rerio OX=7955 GN=dot1l PE=1 SV=2
12	Q04089	2.76e-25	115	582	0.055	0.144	DOT1_YEAST Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DOT1 PE=1 SV=1
13	E9Q6I8	6.13e-22	92.4	49	0.027	0.857	E9Q6I8_MOUSE DOT1-like, histone H3 methyltransferase (S. cerevisiae) OS=Mus musculus OX=10090 GN=Dot1l PE=1 SV=1
14	Q55AX2	8.55e-10	66.2	1845	0.038	0.032	DOT1L_DICDI Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Dictyostelium discoideum OX=44689 GN=dotA PE=2 SV=2
15	Q4GZF2	2.64e-05	50.1	275	0.029	0.160	Q4GZF2_TRYB2 Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.570 PE=3 SV=1
16	Q679P4	2.85e-05	49.7	233	0.016	0.103	Q679P4_MOUSE Histone H3 methyltransferase DOT1 variant d (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=2 SV=1
17	F6S070	2.88e-05	49.7	234	0.016	0.103	F6S070_MOUSE DOT1-like, histone H3 methyltransferase (S. cerevisiae) (Fragment) OS=Mus musculus OX=10090 GN=Dot1l PE=4 SV=1
18	Q581Z0	5.65e-05	49.3	295	0.027	0.142	Q581Z0_TRYB2 Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26N11.380 PE=3 SV=1
19	Q9MA55	0.016	42.4	668	0.020	0.045	ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1
20	Q6ZU15	0.019	41.6	432	0.022	0.079	SEP14_HUMAN Septin-14 OS=Homo sapiens OX=9606 GN=SEPTIN14 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08123 DOT1	3.5e-79	276.6	Histone methylation protein DOT1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381657

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307411	0.999	Protein AF-10
2	9606.ENSP00000369695	0.998	Protein AF-9
3	9606.ENSP00000252674	0.996	Protein ENL
4	9606.ENSP00000484789	0.994	Histone H4
5	9606.ENSP00000244537	0.993	Histone cluster 1 H4 family member f
6	9606.ENSP00000378578	0.990	AF4/FMR2 family member 1
7	9606.ENSP00000479910	0.979	Protein AF-17
8	9606.ENSP00000333277	0.963	Histone cluster 2 H3 family member d
9	9606.ENSP00000212015	0.946	NAD-dependent protein deacetylase sirtuin-1
10	9606.ENSP00000347168	0.941	Histone cluster 1 H4 family member j
11	9606.ENSP00000366956	0.941	Histone cluster 1 H4 family member h
12	9606.ENSP00000366974	0.941	Histone cluster 1 H4 family member b
13	9606.ENSP00000367034	0.941	Histone cluster 1 H4 family member c
14	9606.ENSP00000443017	0.941	Histone cluster 4, H4
15	9606.ENSP00000462355	0.941	Histone cluster 2 H4 family member b
16	9606.ENSP00000462667	0.941	Histone cluster 2 H4 family member a
17	9606.ENSP00000479106	0.941	Histone cluster 1 H4 family member a
18	9606.ENSP00000479461	0.941	Histone cluster 1 H4 family member d
19	9606.ENSP00000479794	0.941	Histone cluster 1 H4 family member k
20	9606.ENSP00000480960	0.941	Histone cluster 1 H4 family member l

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042054	1.000	histone methyltransferase activity
GO:0005515	0.991	protein binding
GO:0003676	0.963	nucleic acid binding
GO:0008757	0.899	S-adenosylmethionine-dependent methyltransferase activity
GO:0140297	0.875	DNA-binding transcription factor binding
GO:0008170	0.870	N-methyltransferase activity
GO:0016279	0.840	protein-lysine N-methyltransferase activity
GO:0140110	0.839	transcription regulator activity
GO:0003712	0.816	transcription coregulator activity
GO:0018024	0.811	histone lysine N-methyltransferase activity
GO:0061629	0.795	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003713	0.604	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0043170	0.978	macromolecule metabolic process
GO:0009987	0.886	cellular process
GO:0050789	0.885	regulation of biological process
GO:0050794	0.876	regulation of cellular process
GO:0044238	0.864	primary metabolic process
GO:0006807	0.823	nitrogen compound metabolic process
GO:0019222	0.791	regulation of metabolic process
GO:0060255	0.782	regulation of macromolecule metabolic process
GO:0031323	0.778	regulation of cellular metabolic process
GO:0051171	0.773	regulation of nitrogen compound metabolic process
GO:0080090	0.772	regulation of primary metabolic process
GO:0010468	0.710	regulation of gene expression
GO:0044237	0.701	cellular metabolic process
GO:0019219	0.692	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.666	positive regulation of biological process
GO:0048522	0.646	positive regulation of cellular process
GO:0006355	0.636	regulation of DNA-templated transcription
GO:1901564	0.615	organonitrogen compound metabolic process
GO:0019538	0.582	protein metabolic process
GO:0043412	0.581	macromolecule modification
GO:0036211	0.570	protein modification process
GO:0044260	0.537	cellular macromolecule metabolic process
GO:0010604	0.535	positive regulation of macromolecule metabolic process
GO:0051173	0.510	positive regulation of nitrogen compound metabolic process
GO:0031325	0.509	positive regulation of cellular metabolic process
GO:0071840	0.481	cellular component organization or biogenesis
GO:0045935	0.465	positive regulation of nucleobase-containing compound metabolic process
GO:0016043	0.459	cellular component organization
GO:0006357	0.385	regulation of transcription by RNA polymerase II
GO:0051254	0.354	positive regulation of RNA metabolic process
GO:0010557	0.353	positive regulation of macromolecule biosynthetic process
GO:0031328	0.352	positive regulation of cellular biosynthetic process
GO:0010467	0.322	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.983	cytoplasm
GO:0032991	0.956	protein-containing complex
GO:0043232	0.870	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:51736	0.840	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]