StarFunc result for job id Q8TEM1

User Input

>input (1887 residues)
MAARGRGLLLLTLSVLLAAGPSAAAAKLNIPKVLLPFTRATRVNFTLEASEGCYRWLSTR
PEVASIEPLGLDEQQCSQKAVVQARLTQPARLTSIIFAEDITTGQVLRCDAIVDLIHDIQ
IVSTTRELYLEDSPLELKIQALDSEGNTFSTLAGLVFEWTIVKDSEADRFSDSHNALRIL
TFLESTYIPPSYISEMEKAAKQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLIL
ENILLNPAYDVYLMVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPGPEGDPARPV
AVLAQDTSMVTALQLGQSSLVLGHRSIRMQGASRLPNSTIYVVEPGYLGFTVHPGDRWVL
ETGRLYEITIEVFDKFSNKVYVSDNIRIETVLPAEFFEVLSSSQNGSYHRIRALKRGQTA
IDAALTSVVDQDGGVHILQVPVWNQQEVEIHIPITLYPSILTFPWQPKTGAYQYTIRAHG
GSGNFSWSSSSHLVATVTVKGVMTTGSDIGFSVIQAHDVQNPLHFGEMKVYVIEPHSMEF
APCQVEARVGQALELPLRISGLMPGGASEVVTLSDCSHFDLAVEVENQGVFQPLPGRLPP
GSEHCSGIRVKAEAQGSTTLLVSYRHGHVHLSAKITIAAYLPLKAVDPSSVALVTLGSSK
EMLFEGGPRPWILEPSKFFQNVTAEDTDSIGLALFAPHSSRNYQQHWILVTCQALGEQVI
ALSVGNKPSLTNPFPAVEPAVVKFVCAPPSRLTLAPVYTSPQLDMSCPLLQQNKQVVPVS
SHRNPRLDLAAYDQEGRRFDNFSSLSIQWESTRPVLASIEPELPMQLVSQDDESGQKKLH
GLQAILVHEASGTTAITATATGYQESHLSSARTKQPHDPLVPLSASIELILVEDVRVSPE
EVTIYNHPGIQAELRIREGSGYFFLNTSTADVVKVAYQEARGVAMVHPLLPGSSTIMIHD
LCLVFPAPAKAVVYVSDIQELYIRVVDKVEIGKTVKAYVRVLDLHKKPFLAKYFPFMDLK
LRAASPIITLVALDEALDNYTITFLIRGVAIGQTSLTASVTNKAGQRINSAPQQIEVFPP
FRLMPRKVTLLIGATMQVTSEGGPQPQSNILFSISNESVALVSAAGLVQGLAIGNGTVSG
LVQAVDAETGKVVIISQDLVQVEVLLLRAVRIRAPIMRMRTGTQMPIYVTGITNHQNPFS
FGNAVPGLTFHWSVTKRDVLDLRGRHHEASIRLPSQYNFAMNVLGRVKGRTGLRVVVKAV
DPTSGQLYGLARELSDEIQVQVFEKLQLLNPEIEAEQILMSPNSYIKLQTNRDGAASLSY
RVLDGPEKVPVVHVDEKGFLASGSMIGTSTIEVIAQEPFGANQTIIVAVKVSPVSYLRVS
MSPVLHTQNKEALVAVPLGMTVTFTVHFHDNSGDVFHAHSSVLNFATNRDDFVQIGKGPT
NNTCVVRTVSVGLTLLRVWDAEHPGLSDFMPLPVLQAISPELSGAMVVGDVLCLATVLTS
LEGLSGTWSSSANSILHIDPKTGVAVARAVGSVTVYYEVAGHLRTYKEVVVSVPQRIMAR
HLHPIQTSFQEATASKVIVAVGDRSSNLRGECTPTQREVIQALHPETLISCQSQFKPAVF
DFPSQDVFTVEPQFDTALGQYFCSITMHRLTDKQRKHLSMKKTALVVSASLSSSHFSTEQ
VGAEVPFSPGLFADQAEILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFG
WPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPGPYGASLF
QHFLDSYQVMFFTLFALLAGTAVMIIAYHTVCTPRDLAVPAALTPRASPGHSPHYFAASS
PTSPNALPPARKASPPSGLWSPAYASH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1Z6H7	0.334	0.336	0.000	1876	0.236	0.237	A1Z6H7.pdb.gz	PO210_DROME Nuclear pore membrane glycoprotein 210 OS=Drosophila melanogaster OX=7227 GN=Gp210 PE=1 SV=1
2	AFDB:F4KHD8	0.259	0.255	0.000	1923	0.212	0.208	F4KHD8.pdb.gz	GP210_ARATH Nuclear pore complex protein GP210 OS=Arabidopsis thaliana OX=3702 GN=GB210 PE=1 SV=1
3	AFDB:P11654	0.443	0.443	0.000	1886	0.837	0.837	P11654.pdb.gz	PO210_RAT Nuclear pore membrane glycoprotein 210 OS=Rattus norvegicus OX=10116 GN=Nup210 PE=1 SV=1
4	AFDB:P91495	0.372	0.379	0.000	1847	0.249	0.254	P91495.pdb.gz	P91495_CAEEL BIG2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-12 PE=1 SV=1
5	AFDB:Q54IS9	0.277	0.273	0.000	1916	0.232	0.229	Q54IS9.pdb.gz	Q54IS9_DICDI Nucleoporin 210 OS=Dictyostelium discoideum OX=44689 GN=nup210 PE=3 SV=1
6	AFDB:Q8TEM1	1.000	1.000	0.000	1887	1.000	1.000	Q8TEM1.pdb.gz	PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3
7	AFDB:Q9D2F7	0.422	0.423	0.000	1881	0.438	0.439	Q9D2F7.pdb.gz	P210L_MOUSE Nuclear pore membrane glycoprotein 210-like OS=Mus musculus OX=10090 GN=Nup210l PE=1 SV=2
8	AFDB:Q9VS29	0.103	0.097	3.643E-35	2074	0.126	0.114	Q9VS29.pdb.gz	DSCL_DROME Cell adhesion molecule Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 PE=2 SV=3
9	AFDB:Q6UVK1	0.086	0.075	2.941E-33	2322	0.129	0.105	Q6UVK1.pdb.gz	CSPG4_HUMAN Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2
10	AFDB:Q9VJ82	0.088	0.074	8.814E-33	2381	0.115	0.091	Q9VJ82.pdb.gz	Q9VJ82_DROME Kon-tiki, isoform B OS=Drosophila melanogaster OX=7227 GN=kon PE=4 SV=3
11	PDB:7sqcO0	0.085	0.119	9.543E-20	1140	0.057	0.095	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.079	0.165	1.506E-16	721	0.047	0.122	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:5a42A	0.087	0.099	4.312E-16	1597	0.073	0.086	5a42A.pdb.gz
14	PDB:7vonA	0.079	0.098	7.927E-14	1399	0.049	0.066	7vonA.pdb.gz
15	PDB:1e07A	0.080	0.196	8.551E-13	642	0.038	0.112	1e07A.pdb.gz
16	PDB:7q1yA	0.077	0.097	1.550E-12	1374	0.055	0.076	7q1yA.pdb.gz
17	PDB:5oj2B	0.095	0.167	3.078E-12	692	0.046	0.124	5oj2B.pdb.gz
18	PDB:4ziqA	0.059	0.070	8.042E-12	1450	0.067	0.087	4ziqA.pdb.gz
19	PDB:7nycA	0.085	0.099	1.159E-11	1542	0.053	0.065	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7q5zA	0.069	0.087	7.563E-11	1344	0.057	0.080	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P11654	0.0	3242	1886	0.837	0.837	PO210_RAT Nuclear pore membrane glycoprotein 210 OS=Rattus norvegicus OX=10116 GN=Nup210 PE=1 SV=1
2	Q8TEM1	0.0	3865	1887	1.000	1.000	PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3
3	Q9D2F7	0.0	1576	1881	0.444	0.445	P210L_MOUSE Nuclear pore membrane glycoprotein 210-like OS=Mus musculus OX=10090 GN=Nup210l PE=1 SV=2
4	Q9QY81	0.0	3241	1886	0.844	0.845	PO210_MOUSE Nuclear pore membrane glycoprotein 210 OS=Mus musculus OX=10090 GN=Nup210 PE=1 SV=2
5	P91495	6.93e-147	502	1847	0.249	0.254	P91495_CAEEL BIG2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=npp-12 PE=1 SV=1
6	A1Z6H7	1.19e-131	458	1876	0.223	0.224	PO210_DROME Nuclear pore membrane glycoprotein 210 OS=Drosophila melanogaster OX=7227 GN=Gp210 PE=1 SV=1
7	Q54IS9	1.15e-123	434	1916	0.223	0.219	Q54IS9_DICDI Nucleoporin 210 OS=Dictyostelium discoideum OX=44689 GN=nup210 PE=3 SV=1
8	F4KHD8	3.27e-67	254	1923	0.198	0.194	GP210_ARATH Nuclear pore complex protein GP210 OS=Arabidopsis thaliana OX=3702 GN=GB210 PE=1 SV=1
9	Q8IYM2	1.6	35.8	578	0.015	0.050	SLN12_HUMAN Ribonuclease SLFN12 OS=Homo sapiens OX=9606 GN=SLFN12 PE=1 SV=2
10	A0A1D8PG20	1.7	35.8	491	0.028	0.106	A0A1D8PG20_CANAL Bifunctional 2-aminoadipate transaminase/aromatic-amino-acid:2-oxoglutarate transaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARO8 PE=4 SV=1
11	P04052	2.7	35.4	1887	0.011	0.011	RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster OX=7227 GN=RpII215 PE=3 SV=4
12	Q68RJ5	3.9	34.7	683	0.019	0.053	IFT81_CHLRE Intraflagellar transport protein 81 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT81 PE=1 SV=1
13	Q8LPS2	6.6	33.9	670	0.022	0.061	ACD6_ARATH Protein ACCELERATED CELL DEATH 6 OS=Arabidopsis thaliana OX=3702 GN=ACD6 PE=1 SV=1
14	Q8L7K9	6.8	33.9	607	0.012	0.036	MAO2_ARATH NAD-dependent malic enzyme 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NAD-ME2 PE=1 SV=1
15	P08968	7.3	33.9	1530	0.009	0.011	RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=1
16	Q08180	7.3	33.9	764	0.013	0.031	ICCR_DROME Irregular chiasm C-roughest protein OS=Drosophila melanogaster OX=7227 GN=rst PE=1 SV=2
17	P00480	7.8	33.5	354	0.012	0.065	OTC_HUMAN Ornithine transcarbamylase, mitochondrial OS=Homo sapiens OX=9606 GN=OTC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02368 Big_2	3e-15	67.2	Bacterial Ig-like domain (group 2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254508

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000444029	0.991	Nuclear pore complex protein Nup153
2	9606.ENSP00000229179	0.989	Nuclear pore complex protein Nup107
3	9606.ENSP00000295119	0.988	Nucleoporin NUP53
4	9606.ENSP00000352400	0.984	Nuclear pore complex protein Nup214
5	9606.ENSP00000471191	0.984	Nuclear pore glycoprotein p62
6	9606.ENSP00000343023	0.983	Nuclear autoantigen Sp-100
7	9606.ENSP00000283195	0.977	E3 SUMO-protein ligase RanBP2
8	9606.ENSP00000316032	0.977	Nuclear pore complex protein Nup98-Nup96
9	9606.ENSP00000231498	0.973	Nuclear pore complex protein Nup155
10	9606.ENSP00000367721	0.972	Nuclear pore complex protein Nup160
11	9606.ENSP00000285968	0.970	Nuclear pore complex protein Nup205
12	9606.ENSP00000310668	0.970	Nuclear pore complex protein Nup93
13	9606.ENSP00000382779	0.969	Nucleoporin SEH1
14	9606.ENSP00000360483	0.965	Nucleoporin NDC1
15	9606.ENSP00000348056	0.959	SUMO-conjugating enzyme UBC9
16	9606.ENSP00000290158	0.954	Importin subunit beta-1
17	9606.ENSP00000401470	0.950	Ran GTPase-activating protein 1
18	9606.ENSP00000345895	0.949	Nuclear pore complex protein Nup50
19	9606.ENSP00000245544	0.945	Nuclear pore complex protein Nup85
20	9606.ENSP00000458954	0.944	Nuclear pore complex protein Nup88

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.364	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043933	0.989	protein-containing complex organization
GO:0022607	0.988	cellular component assembly
GO:0065003	0.910	protein-containing complex assembly
GO:0065007	0.425	biological regulation
GO:0050789	0.416	regulation of biological process
GO:0050794	0.367	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005635	1.000	nuclear envelope
GO:0032991	0.961	protein-containing complex
GO:0016020	0.925	membrane
GO:0140513	0.764	nuclear protein-containing complex
GO:0005737	0.659	cytoplasm
GO:0070013	0.598	intracellular organelle lumen
GO:0031981	0.594	nuclear lumen
GO:0005829	0.526	cytosol
GO:0005654	0.476	nucleoplasm
GO:0005643	0.471	nuclear pore
GO:0043232	0.365	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]