StarFunc result for job id Q8TEP8

User Input

>input (2537 residues)
MEDFRGIAEESFPSFLTNSLFGNSGILENVTLSSNLGLPVAVSTLARDRSSTDNRYPDIQ
ASYLVEGRFSVPSGSSPGSQSDAEPRERLQLSFQDDDSISRKKSYVESQRLSNALSKQSA
LQMETAGPEEEPAGATESLQGQDLFNRASPLEQAQDSPIDFHLQSWMNNKEPKIVVLDAG
KHFEDKTLKSDLSHTSLLENEKLILPTSLEDSSDDDIDDEMFYDDHLEAYFEQLAIPGMI
YEDLEGPEPPEKGFKLPTNGLRQANENGSLNCKFQSENNSSLISLDSHSSETTHKESEES
QVICLPGTSNSIGTGDSRRYTDGMLPFSSGTWGTEKEIENLKGIVPDLNSECASKDVLVK
TLRAIDVKLNSDNFHDANANRGGFDLTDPVKQGAECPHQNKTVLHMDGCLDTETPTVSIQ
ENVDVASLKPISDSGINFTDAIWSPTCERRTCECHESIEKNKDKTDLPQSVVYQNEEGRW
VTDLAYYTSFNSKQNLNVSLSDEMNEDFRSGSEAFDLIAQDEEEFNKEHQFIQEENIDAH
NTSVALGDTSWGATINYSLLRKSRSTSDLDKDDASYLRLSLGEFFAQRSEALGCLGGGNN
VKRPSFGYFIRSPEKREPIALIRKSDVSRGNLEKEMAHLNHDLYSGDLNEQSQAQLSEGS
ITLQVEAVESTSQVDENDVTLTADKGKTEDTFFMSNKPQRYKDKLPDSGDSMLRISTIAS
AIAEASVNTDPSQLAAMIKALSNKTRDKTFQEDEKQKDYSHVRHFLPNDLEKSNGSNALD
MEKYLKKTEVSRYESALENFSRASMSDTWDLSLPKEQTTQDIHPVDLSATSVSVRAPEEN
TAAIVYVENGESENQESFRTINSSNSVTNRENNSAVVDVKTCSIDNKLQDVGNDEKATSI
STPSDSYSSVRNPRITSLCLLKDCEEIRDNRENQRQNECVSEISNSEKHVTFENHRIVSP
KNSDLKNTSPEHGGRGSEDEQESFRPSTSPLSHSSPSEISGTSSSGCALESFGSAAQQQQ
PPCEQELSPLVCSPAGVSRLTYVSEPESSYPTTATDDALEDRKSDITSELSTTIIQGSPA
ALEERAMEKLREKVPFQNRGKGTLSSIIQNNSDTRKATETTSLSSKPEYVKPDFRWSKDP
SSKSGNLLETSEVGWTSNPEELDPIRLALLGKSGLSCQVGSATSHPVSCQEPIDEDQRIS
PKDKSTAGREFSGQVSHQTTSENQCTPIPSSTVHSSVADMQNMPAAVHALLTQPSLSAAP
FAQRYLGTLPSTGSTTLPQCHAGNATVCGFSGGLPYPAVAGEPVQNSVAVGICLGSNIGS
GWMGTSSLCNPYSNTLNQNLLSTTKPFPVPSVGTNCGIEPWDSGVTSGLGSVRVPEELKL
PHACCVGIASQTLLSVLNPTDRWLQVSIGVLSISVNGEKVDLSTYRCLVFKNKAIIRPHA
TEEIKVLFIPSSPGVFRCTFSVASWPCSTDAETIVQAEALASTVTLTAIAESPVIEVETE
KKDVLDFGDLTYGGWKALPLKLINRTHATVPIRLIINANAVAWRCFTFSKESVRAPVEVA
PCADVVTRLAGPSVVNHMMPASYDGQDPEFLMIWVLFHSPKKQISSSDILDSAEEFSAKV
DIEVDSPNPTPVLRSVSLRARAGIARIHAPRDLQTMHFLAKVASSRKQHLPLKNAGNIEV
YLDIKVPEQGSHFSVDPKNLLLKPGEEHEVIVSFTPKDPEACEERILKIFVQPFGPQYEV
VLKGEVISSGSKPLSPGPCLDIPSILSNKQFLAWGGVPLGRTQLQKLALRNNSASTTQHL
RLLIRGQDQDCFQLQNTFGSEQRLTSNCEIRIHPKEDIFISVLFAPTRLSCMLARLEIKQ
LGNRSQPGIKFTIPLSGYGGTSNLILEGVKKLSDSYMVTVNGLVPGKESKIVFSVRNTGS
RAAFVKAVGFKDSQKKVLLDPKVLRIFPDKFVLKERTQENVTLIYNPSDRGINNKTATEL
STVYLFGGDEISRQQYRRALLHKPEMIKQILPEHSVLQNINFVEAFQDELLVTEVYDLPQ
RPNDVQLFYGSMCKIILSVIGEFRDCISSREFLQPSSKASLESTSDLGASGKHGGNVSLD
VLPVKGPQGSPLLSRAARPPLDQLASEEPWTVLPEHLILVAPSPCDMAKTGRFQIVNNSV
RLLRFELCWPAHCLTVTPQHGCVAPESKLQILVSPNSSLSTKQSMFPWSGLIYIHCDDGQ
KKIVKVQIREDLTQVELLTRLTSKPFGILSPVSEPSVSHLVKPMTKPPSTKVEIRNKSIT
FPTTEPGETSESCLELENHGTTDVKWHLSSLAPPYVKGVDESGDVFRATYAAFRCSPISG
LLESHGIQKVSITFLPRGRGDYAQFWDVECHPLKEPHMKHTLRFQLSGQSIEAENEPENA
CLSTDSLIKIDHLVKPRRQAVSEASARIPEQLDVTARGVYAPEDVYRFRPTSVGESRTLK
VNLRNNSFITHSLKFLSPREPFYVKHSKYSLRAQHYINMPVQFKPKSAGKFEALLVIQTD
EGKSIAIRLIGEALGKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q4Y4	0.431	0.434	0.000	2514	0.650	0.656	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
2	AFDB:Q8TEP8	1.000	1.000	0.000	2537	1.000	1.000	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
3	PDB:7sqcO0	0.076	0.142	2.725E-47	1140	0.053	0.118	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
4	AFDB:Q54NE5	0.063	0.081	3.767E-45	1918	0.124	0.164	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
5	AFDB:Q3V1M1	0.067	0.066	1.293E-22	2594	0.098	0.096	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
6	AFDB:Q6WRI0	0.065	0.063	2.040E-22	2623	0.109	0.106	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
7	AFDB:Q6WRH9	0.045	0.045	4.362E-22	2597	0.110	0.108	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
8	AFDB:B7YZW3	0.050	0.059	2.703E-21	2064	0.089	0.110	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
9	PDB:5a42A	0.069	0.088	4.555E-20	1597	0.048	0.077	5a42A.pdb.gz
10	PDB:7q1yA	0.079	0.119	2.083E-19	1374	0.040	0.074	7q1yA.pdb.gz
11	PDB:4lnvA	0.070	0.110	1.663E-18	1276	0.036	0.071	4lnvA.pdb.gz
12	PDB:7q5zA	0.044	0.071	3.557E-18	1344	0.036	0.068	7q5zA.pdb.gz
13	PDB:4ziqA	0.071	0.102	1.141E-17	1450	0.040	0.070	4ziqA.pdb.gz
14	PDB:7vonA	0.072	0.112	4.482E-17	1399	0.043	0.078	7vonA.pdb.gz
15	PDB:6h03A	0.074	0.119	7.654E-16	1223	0.040	0.083	6h03A.pdb.gz
16	PDB:7nycA	0.078	0.105	2.858E-15	1542	0.045	0.075	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:7sqcO1	0.048	0.149	9.431E-14	673	0.020	0.074	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	AFDB:Q04164	0.044	0.058	2.342E-10	1693	0.092	0.138	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
19	AFDB:O88783	0.040	0.044	3.636E-7	2183	0.078	0.091	O88783.pdb.gz	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
20	AFDB:P12259	0.041	0.044	1.054E-6	2224	0.082	0.094	P12259.pdb.gz	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YDK4	0.0	1474	1105	0.301	0.691	A0A286YDK4_MOUSE Centrosomal protein 192 (Fragment) OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
2	E9Q4Y4	0.0	3115	2514	0.652	0.658	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
3	Q6P2K8	0.0	977	640	0.186	0.736	Q6P2K8_MOUSE Cep192 protein OS=Mus musculus OX=10090 GN=Cep192 PE=2 SV=1
4	Q7TMP0	0.0	1203	771	0.229	0.752	Q7TMP0_MOUSE Cep192 protein (Fragment) OS=Mus musculus OX=10090 GN=Cep192 PE=2 SV=1
5	Q8TEP8	0.0	5232	2537	1.000	1.000	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
6	Q9D694	0.0	1244	799	0.238	0.755	Q9D694_MOUSE Centrosomal protein of 192 kDa (Fragment) OS=Mus musculus OX=10090 GN=Cep192 PE=2 SV=2
7	Q8C769	3.45e-160	511	599	0.118	0.499	Q8C769_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cep192 PE=2 SV=2
8	Q54NE5	5.68e-08	61.2	1918	0.033	0.044	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
9	Q9VV79	2.18e-06	55.8	1146	0.025	0.056	Q9VV79_DROME BcDNA.LD24702 OS=Drosophila melanogaster OX=7227 GN=spd-2 PE=1 SV=2
10	Q583L9	3.5	35.8	4521	0.021	0.012	Q583L9_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.940 PE=4 SV=1
11	P96379	4.6	34.7	325	0.011	0.083	MAZG_MYCTU Nucleoside triphosphate pyrophosphohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mazG PE=1 SV=1
12	Q6ZTR5	6.0	34.7	3187	0.014	0.011	CFA47_HUMAN Cilia- and flagella-associated protein 47 OS=Homo sapiens OX=9606 GN=CFAP47 PE=1 SV=5
13	Q9LE89	6.0	34.3	347	0.005	0.037	CLH0_CHEAL Chlorophyllase type 0 OS=Chenopodium album OX=3559 GN=CACLH PE=1 SV=1
14	A8JFU2	7.7	34.3	2118	0.008	0.010	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
15	Q4G0P3	9.2	34.3	5121	0.010	0.005	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
16	Q80W93	9.5	34.3	5154	0.009	0.004	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	1.5e-14	65.3	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF12371 TMEM131_like_N	0.0037	28.8	Transmembrane protein 131-like N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270861	0.994	Serine/threonine-protein kinase PLK4
2	9606.ENSP00000216911	0.969	Aurora kinase A
3	9606.ENSP00000370337	0.932	Centrosomal protein of 152 kDa
4	9606.ENSP00000352572	0.871	Pericentrin
5	9606.ENSP00000451211	0.870	Protein NEDD1
6	9606.ENSP00000343818	0.838	CDK5 regulatory subunit-associated protein 2
7	9606.ENSP00000252992	0.831	Centrosomal protein of 85 kDa
8	9606.ENSP00000358458	0.800	Putative nucleotidyltransferase FAM46C
9	9606.ENSP00000360944	0.799	SCL-interrupting locus protein
10	9606.ENSP00000257287	0.786	Centrosomal protein of 135 kDa
11	9606.ENSP00000287482	0.782	Spindle assembly abnormal protein 6 homolog
12	9606.ENSP00000336524	0.772	Centrosomal protein of 63 kDa
13	9606.ENSP00000469686	0.742	Egl nine homolog 2
14	9606.ENSP00000260372	0.739	HAUS augmin-like complex subunit 2
15	9606.ENSP00000369871	0.731	HAUS augmin-like complex subunit 6
16	9606.ENSP00000382779	0.720	Nucleoporin SEH1
17	9606.ENSP00000300093	0.714	Serine/threonine-protein kinase PLK1
18	9606.ENSP00000371308	0.714	Centromere protein J
19	9606.ENSP00000370021	0.653	Centlein
20	9606.ENSP00000243644	0.642	Zinc finger protein 350

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019902	1.000	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0022402	0.990	cell cycle process
GO:0000226	0.990	microtubule cytoskeleton organization
GO:0022607	0.983	cellular component assembly
GO:0007051	0.962	spindle organization
GO:0000278	0.946	mitotic cell cycle
GO:0140694	0.934	non-membrane-bounded organelle assembly
GO:1903047	0.895	mitotic cell cycle process
GO:0051276	0.877	chromosome organization
GO:0007059	0.872	chromosome segregation
GO:0051641	0.837	cellular localization
GO:0031109	0.820	microtubule polymerization or depolymerization
GO:0050794	0.810	regulation of cellular process
GO:0033036	0.807	macromolecule localization
GO:0140014	0.780	mitotic nuclear division
GO:0008104	0.770	protein localization
GO:0098813	0.769	nuclear chromosome segregation
GO:0051258	0.763	protein polymerization
GO:0046785	0.748	microtubule polymerization
GO:0033365	0.719	protein localization to organelle
GO:0007020	0.714	microtubule nucleation
GO:0000819	0.683	sister chromatid segregation
GO:1902850	0.416	microtubule cytoskeleton organization involved in mitosis
GO:0051225	0.405	spindle assembly
GO:0007052	0.404	mitotic spindle organization
GO:0000070	0.368	mitotic sister chromatid segregation
GO:0051128	0.362	regulation of cellular component organization
GO:0048518	0.326	positive regulation of biological process
GO:0090307	0.317	mitotic spindle assembly
GO:1905508	0.304	protein localization to microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0032991	0.996	protein-containing complex
GO:0005829	0.996	cytosol
GO:0005814	0.942	centriole
GO:0043231	0.816	intracellular membrane-bounded organelle
GO:0120098	0.390	procentriole
GO:0120099	0.382	procentriole replication complex
GO:0005634	0.326	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]