StarFunc result for job id Q8TEQ6

User Input

>input (1508 residues)
MGQEPRTLPPSPNWYCARCSDAVPGGLFGFAARTSVFLVRVGPGAGESPGTPPFRVIGEL
VGHTERVSGFTFSHHPGQYNLCATSSDDGTVKIWDVETKTVVTEHALHQHTISTLHWSPR
VKDLIVSGDEKGVVFCYWFNRNDSQHLFIEPRTIFCLTCSPHHEDLVAIGYKDGIVVIID
ISKKGEVIHRLRGHDDEIHSIAWCPLPGEDCLSINQEETSEEAEITNGNAVAQAPVTKGC
YLATGSKDQTIRIWSCSRGRGVMILKLPFLKRRGGGIDPTVKERLWLTLHWPSNQPTQLV
SSCFGGELLQWDLTQSWRRKYTLFSASSEGQNHSRIVFNLCPLQTEDDKQLLLSTSMDRD
VKCWDIATLECSWTLPSLGGFAYSLAFSSVDIGSLAIGVGDGMIRVWNTLSIKNNYDVKN
FWQGVKSKVTALCWHPTKEGCLAFGTDDGKVGLYDTYSNKPPQISSTYHKKTVYTLAWGP
PVPPMSLGGEGDRPSLALYSCGGEGIVLQHNPWKLSGEAFDINKLIRDTNSIKYKLPVHT
EISWKADGKIMALGNEDGSIEIFQIPNLKLICTIQQHHKLVNTISWHHEHGSQPELSYLM
ASGSNNAVIYVHNLKTVIESSPESPVTITEPYRTLSGHTAKITSVAWSPHHDGRLVSASY
DGTAQVWDALREEPLCNFRGHRGRLLCVAWSPLDPDCIYSGADDFCVHKWLTSMQDHSRP
PQGKKSIELEKKRLSQPKAKPKKKKKPTLRTPVKLESIDGNEEESMKENSGPVENGVSDQ
EGEEQAREPELPCGLAPAVSREPVICTPVSSGFEKSKVTINNKVILLKKEPPKEKPETLI
KKRKARSLLPLSTSLDHRSKEELHQDCLVLATAKHSRELNEDVSADVEERFHLGLFTDRA
TLYRMIDIEGKGHLENGHPELFHQLMLWKGDLKGVLQTAAERGELTDNLVAMAPAAGYHV
WLWAVEAFAKQLCFQDQYVKAASHLLSIHKVYEAVELLKSNHFYREAIAIAKARLRPEDP
VLKDLYLSWGTVLERDGHYAVAAKCYLGATCAYDAAKVLAKKGDAASLRTAAELAAIVGE
DELSASLALRCAQELLLANNWVGAQEALQLHESLQGQRLVFCLLELLSRHLEEKQLSEGK
SSSSYHTWNTGTEGPFVERVTAVWKSIFSLDTPEQYQEAFQKLQNIKYPSATNNTPAKQL
LLHICHDLTLAVLSQQMASWDEAVQALLRAVVRSYDSGSFTIMQEVYSAFLPDGCDHLRD
KLGDHQSPATPAFKSLEAFFLYGRLYEFWWSLSRPCPNSSVWVRAGHRTLSVEPSQQLDT
ASTEETDPETSQPEPNRPSELDLRLTEEGERMLSTFKELFSEKHASLQNSQRTVAEVQET
LAEMIRQHQKSQLCKSTANGPDKNEPEVEAEQPLCSSQSQCKEEKNEPLSLPELTKRLTE
ANQRMAKFPESIKAWPFPDVLECCLVLLLIRSHFPGCLAQEMQQQAQELLQKYGNTKTYR
RHCQTFCM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BX17	0.779	0.782	0.000	1502	0.821	0.824	Q8BX17.pdb.gz	GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus OX=10090 GN=Gemin5 PE=1 SV=2
2	AFDB:Q8TEQ6	1.000	1.000	0.000	1508	1.000	1.000	Q8TEQ6.pdb.gz	GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3
3	PDB:7ajuUL	0.245	0.395	7.066E-26	779	0.073	0.141	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
4	PDB:7mqaLQ	0.262	0.411	1.830E-25	830	0.078	0.141	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7mq8LR	0.297	0.520	4.139E-25	773	0.068	0.133	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7ajtUM	0.301	0.538	9.358E-25	762	0.066	0.130	7ajtUM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
7	PDB:7d5sB2	0.252	0.386	2.536E-24	851	0.074	0.130	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
8	PDB:1nr0A	0.349	0.814	3.848E-23	610	0.069	0.170	1nr0A.pdb.gz
9	PDB:6nd4Q	0.246	0.370	2.358E-22	862	0.067	0.117	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
10	PDB:7mq8LT	0.216	0.325	1.006E-21	869	0.094	0.163	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:5m2nA	0.336	0.663	1.381E-21	711	0.073	0.155	5m2nA.pdb.gz
12	PDB:7mqaLO	0.308	0.524	4.528E-20	819	0.056	0.104	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:A0A0R4INC0	0.285	0.472	3.258E-16	840	0.064	0.114	A0A0R4INC0.pdb.gz
14	AFDB:A0A0B4LG18	0.181	0.354	2.921E-13	740	0.043	0.088	A0A0B4LG18.pdb.gz	A0A0B4LG18_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9313 PE=4 SV=1
15	AFDB:F1SF88	0.186	0.430	1.190E-12	622	0.039	0.095	F1SF88.pdb.gz	F1SF88_PIG Dynein cytoplasmic 1 intermediate chain 1 OS=Sus scrofa OX=9823 GN=DYNC1I1 PE=1 SV=5
16	AFDB:Q9P775	0.142	0.399	2.715E-11	516	0.036	0.107	Q9P775.pdb.gz	YBEG_SCHPO Uncharacterized WD repeat-containing protein C17D11.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1711.16 PE=1 SV=1
17	AFDB:A0A096UWG1	0.136	0.272	3.406E-11	733	0.037	0.076	A0A096UWG1.pdb.gz	A0A096UWG1_RAT COP1, E3 ubiquitin ligase OS=Rattus norvegicus OX=10116 GN=Cop1 PE=1 SV=2
18	AFDB:Q57UM8	0.149	0.233	3.564E-11	904	0.081	0.135	Q57UM8.pdb.gz	Q57UM8_TRYB2 Immunodominant antigen, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.700 PE=4 SV=1
19	AFDB:C8V0I4	0.185	0.470	3.902E-11	574	0.040	0.106	C8V0I4.pdb.gz	C8V0I4_EMENI Transcriptional corepressor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06505 PE=4 SV=1
20	AFDB:Q94BM7	0.174	0.323	5.868E-11	794	0.034	0.065	Q94BM7.pdb.gz	SPA4_ARATH Protein SPA1-RELATED 4 OS=Arabidopsis thaliana OX=3702 GN=SPA4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QH84	0.0	1511	1440	0.513	0.537	E9QH84_DANRE Gem (nuclear organelle)-associated protein 5 OS=Danio rerio OX=7955 GN=gemin5 PE=1 SV=1
2	Q8BX17	0.0	2550	1502	0.823	0.826	GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus OX=10090 GN=Gemin5 PE=1 SV=2
3	Q8TEQ6	0.0	3132	1508	1.000	1.000	GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3
4	Q24044	2.78e-12	73.6	526	0.031	0.089	Q24044_DROME FI02843p OS=Drosophila melanogaster OX=7227 GN=fzy PE=2 SV=1
5	Q6NR32	3.22e-12	73.6	526	0.031	0.089	Q6NR32_DROME RE39287p OS=Drosophila melanogaster OX=7227 GN=fzy PE=2 SV=1
6	Q54MZ3	1.85e-11	70.9	499	0.029	0.088	CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum OX=44689 GN=cdc20 PE=1 SV=1
7	Q9FLX9	2.77e-11	70.1	473	0.034	0.110	NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana OX=3702 GN=NLE1 PE=2 SV=1
8	Q8VEJ4	5.34e-11	69.3	485	0.062	0.192	NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus OX=10090 GN=Nle1 PE=1 SV=4
9	Q8QFR2	7.52e-11	69.7	1013	0.036	0.053	HIRA_XENLA Protein HIRA OS=Xenopus laevis OX=8355 GN=hira PE=1 SV=2
10	Q86BY9	1.48e-10	68.9	1235	0.098	0.120	RIG_DROME Protein rigor mortis OS=Drosophila melanogaster OX=7227 GN=rig PE=1 SV=1
11	P25382	1.58e-10	67.8	515	0.059	0.173	NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSA4 PE=1 SV=3
12	Q12834	1.60e-10	67.8	499	0.033	0.100	CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens OX=9606 GN=CDC20 PE=1 SV=2
13	Q9LXN4	2.25e-10	68.2	1024	0.037	0.055	HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana OX=3702 GN=HIRA PE=1 SV=2
14	Q9JJ66	2.62e-10	67.0	499	0.029	0.088	CDC20_MOUSE Cell division cycle protein 20 homolog OS=Mus musculus OX=10090 GN=Cdc20 PE=1 SV=2
15	Q62623	2.93e-10	67.0	499	0.029	0.088	CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus OX=10116 GN=Cdc20 PE=1 SV=2
16	Q8AVG7	3.76e-10	66.6	506	0.034	0.103	Q8AVG7_XENLA Cdc20 protein OS=Xenopus laevis OX=8355 GN=cdc20.S PE=1 SV=1
17	Q5H7C0	9.25e-10	65.5	499	0.032	0.098	CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa OX=9823 GN=CDC20 PE=2 SV=1
18	Q9FN19	1.02e-09	65.5	613	0.058	0.144	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
19	P79987	1.14e-09	65.9	1019	0.031	0.046	HIRA_CHICK Protein HIRA OS=Gallus gallus OX=9031 GN=HIRA PE=1 SV=2
20	Q5B915	1.19e-09	65.5	592	0.030	0.076	Q5B915_EMENI Cell cycle regulatory protein (Srw1), putative (AFU_orthologue AFUA_3G08280) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02965 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.2e-24	96.3	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16529 Ge1_WD40	3.8e+02	11.5	WD40 region of Ge1, enhancer of mRNA-decapping protein
3	PF08596 Lgl_C	62	13.7	Lethal giant larvae(Lgl) like, C-terminal
4	PF20426 NBCH_WD40	0.00043	30.8	Neurobeachin beta propeller domain
5	PF11715 Nup160	0.31	21.4	Nucleoporin Nup120/160
6	PF00400 WD40	9.9e-19	78.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285873

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000321706	0.998	Gem-associated protein 4
2	9606.ENSP00000358716	0.998	Probable ATP-dependent RNA helicase DDX20
3	9606.ENSP00000281950	0.997	Gem-associated protein 6
4	9606.ENSP00000308533	0.997	Gem-associated protein 2
5	9606.ENSP00000370083	0.993	Survival of motor neuron 1, telomeric
6	9606.ENSP00000392270	0.992	Serine-threonine kinase receptor-associated protein
7	9606.ENSP00000300413	0.988	Small nuclear ribonucleoprotein Sm D1
8	9606.ENSP00000369895	0.987	Gem-associated protein 8
9	9606.ENSP00000270257	0.981	Gem-associated protein 7
10	9606.ENSP00000400591	0.969	Small nuclear ribonucleoprotein E
11	9606.ENSP00000266735	0.967	Small nuclear ribonucleoprotein F
12	9606.ENSP00000342374	0.965	Small nuclear ribonucleoprotein Sm D2
13	9606.ENSP00000370119	0.963	Survival motor neuron protein
14	9606.ENSP00000215829	0.962	Small nuclear ribonucleoprotein Sm D3
15	9606.ENSP00000412566	0.957	Small nuclear ribonucleoprotein-associated proteins B and B
16	9606.ENSP00000319169	0.953	Protein arginine N-methyltransferase 5
17	9606.ENSP00000272348	0.946	Small nuclear ribonucleoprotein G
18	9606.ENSP00000260129	0.945	Trimethylguanosine synthase
19	9606.ENSP00000433919	0.934	Methylosome subunit pICln
20	9606.ENSP00000235090	0.930	Methylosome protein 50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0044877	0.848	protein-containing complex binding
GO:0043021	0.827	ribonucleoprotein complex binding
GO:0017069	0.820	snRNA binding
GO:0043022	0.819	ribosome binding
GO:0000339	0.814	RNA cap binding
GO:0000340	0.802	RNA 7-methylguanosine cap binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0090304	0.990	nucleic acid metabolic process
GO:0010467	0.987	gene expression
GO:0016043	0.985	cellular component organization
GO:0022613	0.976	ribonucleoprotein complex biogenesis
GO:0016070	0.975	RNA metabolic process
GO:0050789	0.968	regulation of biological process
GO:0071826	0.968	ribonucleoprotein complex subunit organization
GO:0022607	0.959	cellular component assembly
GO:0050794	0.938	regulation of cellular process
GO:0000398	0.936	mRNA splicing, via spliceosome
GO:0022618	0.932	ribonucleoprotein complex assembly
GO:0010468	0.876	regulation of gene expression
GO:0051171	0.838	regulation of nitrogen compound metabolic process
GO:0031323	0.833	regulation of cellular metabolic process
GO:0080090	0.832	regulation of primary metabolic process
GO:0000387	0.830	spliceosomal snRNP assembly
GO:0010556	0.581	regulation of macromolecule biosynthetic process
GO:0031326	0.581	regulation of cellular biosynthetic process
GO:0051246	0.315	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.998	membrane
GO:0140513	0.987	nuclear protein-containing complex
GO:0120114	0.984	Sm-like protein family complex
GO:0016604	0.940	nuclear body
GO:0034719	0.863	SMN-Sm protein complex
GO:0005667	0.850	transcription regulator complex
GO:0032797	0.757	SMN complex
GO:0034718	0.446	SMN-Gemin2 complex
GO:0043232	0.399	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]