StarFunc result for job id Q8TEQ8

User Input

>input (1089 residues)
MQKASVLLFLAWVCFLFYAGIALFTSGFLLTRLELTNHSSCQEPPGPGSLPWGSQGKPGA
CWMASRFSRVVLVLIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARL
YRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNLIKQLTSAGRRVVFMGDD
TWKDLFPGAFSKAFFFPSFNVRDLDTVDNGILEHLYPTMDSGEWDVLIAHFLGVDHCGHK
HGPHHPEMAKKLSQMDQVIQGLVERLENDTLLVVAGDHGMTTNGDHGGDSELEVSAALFL
YSPTAVFPSTPPEEPEVIPQVSLVPTLALLLGLPIPFGNIGEVMAELFSGGEDSQPHSSA
LAQASALHLNAQQVSRFLHTYSAATQDLQAKELHQLQNLFSKASADYQWLLQSPKGAEAT
LPTVIAELQQFLRGARAMCIESWARFSLVRMAGGTALLAASCFICLLASQWAISPGFPFC
PLLLTPVAWGLVGAIAYAGLLGTIELKLDLVLLGAVAAVSSFLPFLWKAWAGWGSKRPLA
TLFPIPGPVLLLLLFRLAVFFSDSFVVAEARATPFLLGSFILLLVVQLHWEGQLLPPKLL
TMPRLGTSATTNPPRHNGAYALRLGIGLLLCTRLAGLFHRCPEETPVCHSSPWLSPLASM
VGGRAKNLWYGACVAALVALLAAVRLWLRRYGNLKSPEPPMLFVRWGLPLMALGTAAYWA
LASGADEAPPRLRVLVSGASMVLPRAVAGLAASGLALLLWKPVTVLVKAGAGAPRTRTVL
TPFSGPPTSQADLDYVVPQIYRHMQEEFRGRLERTKSQGPLTVAAYQLGSVYSAAMVTAL
TLLAFPLLLLHAERISLVFLLLFLQSFLLLHLLAAGIPVTTPGPFTVPWQAVSAWALMAT
QTFYSTGHQPVFPAIHWHAAFVGFPEGHGSCTWLPALLVGANTFASHLLFAVGCPLLLLW
PFLCESQGLRKRQQPPGNEADARVRPEEEEEPLMEMRLRDAPQHFYAALLQLGLKYLFIL
GIQILACALAASILRRHLMVWKVFAPKFIFEAVGFIVSSVGLLLGIALVMRVDGAVSSWF
RQLFLAQQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEQ8	1.000	1.000	0.000	1089	1.000	1.000	Q8TEQ8.pdb.gz	PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens OX=9606 GN=PIGO PE=1 SV=3
2	AFDB:Q9JJI6	0.940	0.936	0.000	1093	0.861	0.858	Q9JJI6.pdb.gz	PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus OX=10090 GN=Pigo PE=1 SV=2
3	AFDB:Q07830	0.760	0.811	9.727E-53	1017	0.256	0.274	Q07830.pdb.gz	GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI13 PE=1 SV=1
4	AFDB:O13663	0.722	0.849	1.290E-49	918	0.229	0.271	O13663.pdb.gz	GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi13 PE=3 SV=1
5	AFDB:Q5H8A4	0.664	0.730	1.137E-41	983	0.217	0.240	Q5H8A4.pdb.gz	PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens OX=9606 GN=PIGG PE=1 SV=1
6	AFDB:F4IJJ8	0.696	0.785	4.990E-39	958	0.208	0.237	F4IJJ8.pdb.gz	F4IJJ8_ARATH GPI ethanolamine phosphate transferase 2 OS=Arabidopsis thaliana OX=3702 GN=At2g22530 PE=1 SV=1
7	AFDB:Q551Y7	0.685	0.532	2.513E-38	1442	0.216	0.163	Q551Y7.pdb.gz	Q551Y7_DICDI Transmembrane protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276251 PE=4 SV=1
8	AFDB:Q385R1	0.555	0.704	2.424E-31	838	0.194	0.252	Q385R1.pdb.gz	Q385R1_TRYB2 GPI ethanolamine phosphate transferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2720 PE=3 SV=1
9	AFDB:Q09782	0.547	0.767	3.407E-31	758	0.188	0.270	Q09782.pdb.gz	GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=las21 PE=3 SV=1
10	AFDB:P40367	0.570	0.730	5.648E-30	830	0.182	0.239	P40367.pdb.gz	GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS21 PE=1 SV=1
11	PDB:6xlpA	0.172	0.297	2.215E-5	586	0.041	0.077	6xlpA.pdb.gz	Structure of the essential inner membrane lipopolysaccharide-PbgA complex.
12	PDB:2ifyA	0.138	0.278	2.859E-5	508	0.029	0.063	2ifyA.pdb.gz	Structure and Molecular Mechanism of Bacillus anthracis Cofactor-Independent Phosphoglycerate Mutase: A Crucial Enzyme for Spores and Growing Cells of Bacillus Species.
13	PDB:5venA	0.192	0.507	4.192E-5	382	0.045	0.128	5venA.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
14	PDB:2w8sB	0.188	0.361	5.411E-5	513	0.053	0.113	2w8sB.pdb.gz	An Efficient, Multiply Promiscuous Hydrolase in the Alkaline Phosphatase Superfamily.
15	PDB:6c01A	0.195	0.254	6.694E-5	819	0.051	0.067	6c01A.pdb.gz	Structural basis for nucleotide recognition by the ectoenzyme CD203c.
16	PDB:1ei6A	0.150	0.379	7.605E-5	404	0.034	0.092	1ei6A.pdb.gz	Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
17	PDB:7tl7A	0.136	0.260	1.069E-4	531	0.026	0.053	7tl7A.pdb.gz	Serum-Stable and Selective Backbone-N-Methylated Cyclic Peptides That Inhibit Prokaryotic Glycolytic Mutases.
18	PDB:5vemB	0.184	0.482	1.115E-4	383	0.046	0.131	5vemB.pdb.gz	A key tyrosine substitution restricts nucleotide hydrolysis by the ectoenzyme NPP5.
19	PDB:1n2lA	0.187	0.384	2.203E-4	483	0.050	0.112	1n2lA.pdb.gz	Crystal structure of a covalent intermediate of endogenous human arylsulfatase A.
20	PDB:1o98A	0.145	0.295	3.372E-4	509	0.028	0.061	1o98A.pdb.gz	Insights Into the Catalytic Mechanism of Cofactor-Independent Phosphoglycerate Mutase from X-Ray Crystallography, Simulated Dynamics and Molecular Modeling

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TEQ8	0.0	2182	1089	1.000	1.000	PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens OX=9606 GN=PIGO PE=1 SV=3
2	Q9JJI6	0.0	1688	1093	0.859	0.855	PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus OX=10090 GN=Pigo PE=1 SV=2
3	O13663	1.15e-80	285	918	0.158	0.187	GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi13 PE=3 SV=1
4	Q07830	8.50e-80	284	1017	0.239	0.256	GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI13 PE=1 SV=1
5	Q5H8A4	7.26e-55	209	983	0.125	0.138	PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens OX=9606 GN=PIGG PE=1 SV=1
6	F4IJJ8	4.24e-49	191	958	0.100	0.114	F4IJJ8_ARATH GPI ethanolamine phosphate transferase 2 OS=Arabidopsis thaliana OX=3702 GN=At2g22530 PE=1 SV=1
7	Q09782	1.01e-48	188	758	0.108	0.156	GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=las21 PE=3 SV=1
8	Q385R1	1.39e-45	179	838	0.121	0.158	Q385R1_TRYB2 GPI ethanolamine phosphate transferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2720 PE=3 SV=1
9	P40367	1.67e-44	176	830	0.125	0.164	GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS21 PE=1 SV=1
10	Q551Y7	1.30e-39	162	1442	0.096	0.073	Q551Y7_DICDI Transmembrane protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276251 PE=4 SV=1
11	Q8I5R4	1.11e-30	134	1373	0.070	0.055	Q8I5R4_PLAF7 GPI ethanolamine phosphate transferase 3, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1214100 PE=4 SV=2
12	G4SNP0	3.72e-07	57.0	912	0.043	0.052	G4SNP0_CAEEL GPI ethanolamine phosphate transferase 1 OS=Caenorhabditis elegans OX=6239 GN=pign-1 PE=1 SV=2
13	Q9R1S3	6.07e-06	53.1	931	0.036	0.042	PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus OX=10090 GN=Pign PE=2 SV=2
14	P36051	8.42e-06	52.4	919	0.094	0.111	MCD4_YEAST GPI ethanolamine phosphate transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCD4 PE=1 SV=1
15	A0A1W2PS19	1.56e-05	51.6	936	0.034	0.040	A0A1W2PS19_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
16	A0A1W2PQA9	1.70e-05	51.6	970	0.034	0.038	A0A1W2PQA9_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
17	A0A1W2PQP4	1.81e-05	51.2	870	0.034	0.043	A0A1W2PQP4_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
18	A0A1W2PNR0	1.83e-05	51.2	897	0.034	0.041	A0A1W2PNR0_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
19	A0A1W2PQR8	2.19e-05	51.2	854	0.034	0.043	A0A1W2PQR8_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1
20	A0A1W2PPR7	2.20e-05	51.2	797	0.034	0.046	A0A1W2PPR7_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens OX=9606 GN=PIGN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01676 Metalloenzyme	0.083	23.8	Metalloenzyme superfamily
2	PF08665 PglZ	3.9e+02	12.5	PglZ domain
3	PF01663 Phosphodiest	9.8e-13	60.0	Type I phosphodiesterase / nucleotide pyrophosphatase
4	PF19316 PIGO_PIGG	0.79	20.3	GPI ethanolamine phosphate transferase membrane region
5	PF00884 Sulfatase	2.3	19.1	Sulfatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367880

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000164305	0.989	GPI mannosyltransferase 3
2	9606.ENSP00000359848	0.955	GPI-anchor transamidase
3	9606.ENSP00000347206	0.950	Glycosylphosphatidylinositol anchor attachment 1 protein
4	9606.ENSP00000279036	0.949	GPI transamidase component PIG-T
5	9606.ENSP00000363260	0.947	GPI mannosyltransferase 2
6	9606.ENSP00000281382	0.946	Phosphatidylinositol-glycan biosynthesis class F protein
7	9606.ENSP00000225609	0.909	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
8	9606.ENSP00000217446	0.886	Phosphatidylinositol glycan anchor biosynthesis class U protein
9	9606.ENSP00000357069	0.884	GPI mannosyltransferase 1
10	9606.ENSP00000300658	0.883	Post-GPI attachment to proteins factor 3
11	9606.ENSP00000278243	0.878	Post-GPI attachment to proteins factor 2
12	9606.ENSP00000026218	0.868	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
13	9606.ENSP00000420037	0.849	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
14	9606.ENSP00000413405	0.838	GPI mannosyltransferase 4
15	9606.ENSP00000216452	0.832	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
16	9606.ENSP00000482202	0.830	Phosphatidylinositol-glycan biosynthesis class W protein
17	9606.ENSP00000369820	0.820	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
18	9606.ENSP00000296603	0.777	Recruited to ligand-activated beta-2 adrenergic receptor/ADRB2, it negatively regulates the adrenergic receptor signaling pathway . May also regulate other G-protein coupled receptors including type-1 angiotensin II receptor/AGTR1 (Probable)
19	9606.ENSP00000250124	0.769	Mannose-P-dolichol utilization defect 1 protein
20	9606.ENSP00000443598	0.748	Protein FAM214A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016780	1.000	phosphotransferase activity, for other substituted phosphate groups
GO:0005515	0.989	protein binding
GO:0051377	0.951	mannose-ethanolamine phosphotransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:1901564	0.992	organonitrogen compound metabolic process
GO:1901135	0.989	carbohydrate derivative metabolic process
GO:1901576	0.977	organic substance biosynthetic process
GO:0044249	0.975	cellular biosynthetic process
GO:0019538	0.975	protein metabolic process
GO:0044260	0.974	cellular macromolecule metabolic process
GO:0006796	0.970	phosphate-containing compound metabolic process
GO:1901566	0.964	organonitrogen compound biosynthetic process
GO:0036211	0.956	protein modification process
GO:1901137	0.955	carbohydrate derivative biosynthetic process
GO:0006506	0.947	GPI anchor biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0012505	0.997	endomembrane system
GO:0043227	0.991	membrane-bounded organelle
GO:0005737	0.985	cytoplasm
GO:0043231	0.984	intracellular membrane-bounded organelle
GO:0031090	0.978	organelle membrane
GO:0005789	0.963	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.8.-	1.000	Transferases for other substituted phosphate groups.

[back to server]