StarFunc result for job id Q8TER0

User Input

>input (1413 residues)
MRHGVAWALLVAAALGLGARGVRGAVALADFYPFGAERGDAVTPKQDDGGSGLRPLSVPF
PFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYRE
ATDPAMLRRATEDVRHYFPELLDFNATWVFVATWYRVTFFGGSSSSPVNTFQTVLITDGK
LSFTIFNYESIVWTTGTHASSGGNATGLGGIAAQAGFNAGDGQRYFSIPGSRTADMAEVE
TTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLALRPCLNGGKCIDDCVTGNPSYTCSCL
SGFTGRRCHLDVNECASQPCQNGGTCTHGINSFRCQCPAGFGGPTCETAQSPCDTKECQH
GGQCQVENGSAVCVCQAGYTGAACEMDVDDCSPDPCLNGGSCVDLVGNYTCLCAEPFKGL
RCETGDHPVPDACLSAPCHNGGTCVDADQGYVCECPEGFMGLDCRERVPDDCECRNGGRC
LGANTTLCQCPLGFFGLLCEFEITAMPCNMNTQCPDGGYCMEHGGSYLCVCHTDHNASHS
LPSPCDSDPCFNGGSCDAHDDSYTCECPRGFHGKHCEKARPHLCSSGPCRNGGTCKEAGG
EYHCSCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSP
CFRSPCVNGGTCEDRDTDFFCHCQAGYMGRRCQAEVDCGPPEEVKHATLRFNGTRLGAVA
LYACDRGYSLSAPSRIRVCQPHGVWSEPPQCLEIDECRSQPCLHGGSCQDRVAGYLCLCS
TGYEGAHCELERDECRAHPCRNGGSCRNLPGAYVCRCPAGFVGVHCETEVDACDSSPCQH
GGRCESGGGAYLCVCPESFFGYHCETVSDPCFSSPCGGRGYCLASNGSHSCTCKVGYTGE
DCAKELFPPTALKMERVEESGVSISWNPPNGPAARQMLDGYAVTYVSSDGSYRRTDFVDR
TRSSHQLQALAAGRAYNISVFSVKRNSNNKNDISRPAVLLARTRPRPVEGFEVTNVTAST
ISVQWALHRIRHATVSGVRVSIRHPEALRDQATDVDRSVDRFTFRALLPGKRYTIQLTTL
SGLRGEEHPTESLATAPTHVWTRPLPPANLTAARVTATSAHVVWDAPTPGSLLEAYVINV
TTSQSTKSRYVPNGKLASYTVRDLLPGRRYQLSVIAVQSTELGPQHSEPAHLYIITSPRD
GADRRWHQGGHHPRVLKNRPPPARLPELRLLNDHSAPETPTQPPRFSELVDGRGRVSARF
GGSPSKAATVRSQPTASAQLENMEEAPKRVSLALQLPEHGSKDIGNVPGNCSENPCQNGG
TCVPGADAHSCDCGPGFKGRRCELACIKVSRPCTRLFSETKAFPVWEGGVCHHVYKRVYR
VHQDICFKESCESTSLKKTPNRKQSKSQTLEKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q70E20	0.336	0.339	0.000	1403	0.834	0.840	Q70E20.pdb.gz	SNED1_MOUSE Sushi, nidogen and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sned1 PE=2 SV=2
2	AFDB:Q8TER0	1.000	1.000	0.000	1413	1.000	1.000	Q8TER0.pdb.gz	SNED1_HUMAN Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNED1 PE=1 SV=2
3	AFDB:Q9UM47	0.122	0.081	6.069E-47	2321	0.204	0.124	Q9UM47.pdb.gz	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
4	AFDB:F1RCH4	0.091	0.058	7.005E-47	2475	0.160	0.091	F1RCH4.pdb.gz	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
5	AFDB:P46530	0.080	0.053	3.554E-46	2437	0.170	0.098	P46530.pdb.gz	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
6	AFDB:Q99466	0.106	0.080	3.198E-45	2003	0.169	0.119	Q99466.pdb.gz	NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens OX=9606 GN=NOTCH4 PE=1 SV=2
7	AFDB:P46531	0.112	0.068	3.355E-45	2555	0.156	0.086	P46531.pdb.gz	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
8	AFDB:Q90Y57	0.084	0.092	2.245E-43	1242	0.185	0.211	Q90Y57.pdb.gz	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1
9	AFDB:Q9QYE5	0.082	0.091	1.025E-41	1247	0.185	0.210	Q9QYE5.pdb.gz	JAG2_MOUSE Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 PE=2 SV=2
10	AFDB:Q63722	0.081	0.091	2.932E-41	1219	0.177	0.205	Q63722.pdb.gz	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
11	PDB:8eyyA	0.121	0.191	2.321E-13	775	0.038	0.068	8eyyA.pdb.gz
12	PDB:8dtlA	0.125	0.201	1.810E-12	741	0.035	0.066	8dtlA.pdb.gz
13	PDB:6pxvA	0.124	0.186	2.529E-12	823	0.037	0.063	6pxvA.pdb.gz
14	PDB:6pyhD	0.118	0.173	1.101E-10	798	0.038	0.066	6pyhD.pdb.gz
15	PDB:7q5zA	0.078	0.080	4.073E-7	1344	0.045	0.048	7q5zA.pdb.gz
16	PDB:5oj2B	0.095	0.152	6.888E-7	692	0.033	0.066	5oj2B.pdb.gz
17	PDB:7u7nC	0.096	0.485	9.173E-7	200	0.025	0.180	7u7nC.pdb.gz
18	PDB:7q1yA	0.074	0.076	1.165E-6	1374	0.035	0.036	7q1yA.pdb.gz
19	PDB:7bwaA	0.090	0.161	1.790E-6	674	0.021	0.045	7bwaA.pdb.gz
20	PDB:2gsxA	0.051	0.072	2.066E-6	951	0.084	0.125	2gsxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q70E20	0.0	2436	1403	0.824	0.830	SNED1_MOUSE Sushi, nidogen and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sned1 PE=2 SV=2
2	Q8TER0	0.0	2896	1413	1.000	1.000	SNED1_HUMAN Sushi, nidogen and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNED1 PE=1 SV=2
3	P07207	5.02e-110	388	2703	0.168	0.088	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
4	P21783	7.42e-108	381	2524	0.179	0.100	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
5	A2RUV0	4.29e-106	376	2522	0.171	0.096	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
6	A0PGH6	6.24e-106	375	2465	0.175	0.100	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
7	P46531	2.45e-104	370	2555	0.174	0.096	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
8	Q800E4	9.35e-103	365	2468	0.165	0.094	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
9	Q07008	1.31e-102	365	2531	0.170	0.095	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
10	G3I6Z6	1.80e-102	365	2527	0.171	0.095	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
11	Q01705	6.87e-102	363	2531	0.170	0.095	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
12	O35516	1.31e-101	362	2473	0.166	0.095	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
13	Q9QW30	1.37e-101	362	2471	0.161	0.092	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
14	P46530	1.93e-101	361	2437	0.163	0.094	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
15	F1RCH4	1.55e-100	358	2475	0.174	0.099	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
16	Q04721	1.49e-99	355	2471	0.161	0.092	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
17	Q61982	2.00e-96	346	2318	0.173	0.105	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1
18	Q9R172	3.62e-96	345	2319	0.171	0.104	NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2
19	Q9UM47	1.36e-94	340	2321	0.171	0.104	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
20	B8JI71	3.96e-94	339	2904	0.166	0.081	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	3.7	18.9	Complement Clr-like EGF-like
2	PF00008 EGF	8.5e-90	305.8	EGF-like domain
3	PF07974 EGF_2	1.3e-26	103.9	EGF-like domain
4	PF07645 EGF_CA	4.3e-10	50.9	Calcium-binding EGF domain
5	PF00041 fn3	1.3e-31	120.1	Fibronectin type III domain
6	PF12661 hEGF	4e-53	187.6	Human growth factor-like EGF
7	PF06119 NIDO	2.4e-23	94.1	Nidogen-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308893

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287641	0.838	Somatostatin
2	9606.ENSP00000376440	0.700	Cell cycle checkpoint control protein RAD9B
3	9606.ENSP00000367878	0.699	UPF0705 protein C11orf49
4	9606.ENSP00000386444	0.662	S-arrestin
5	9606.ENSP00000328923	0.659	KN motif and ankyrin repeat domain-containing protein 3
6	9606.ENSP00000373586	0.657	Uncharacterized protein C2orf54
7	9606.ENSP00000385006	0.656	THAP domain containing 4
8	9606.ENSP00000385887	0.653	Ankyrin repeat and MYND domain containing 1
9	9606.ENSP00000264042	0.609	FERM, ARHGEF and pleckstrin domain-containing protein 2
10	9606.ENSP00000325748	0.605	Serine/threonine-protein kinase 25
11	9606.ENSP00000274979	0.603	Anoctamin-7
12	9606.ENSP00000366248	0.603	Cortistatin
13	9606.ENSP00000304802	0.593	Thymidylate kinase
14	9606.ENSP00000479861	0.590	Septin-2
15	9606.ENSP00000324191	0.577	Potassium channel regulatory protein
16	9606.ENSP00000350198	0.557	Somatostatin receptor type 2
17	9606.ENSP00000354774	0.557	SPRY domain containing 7
18	9606.ENSP00000358513	0.544	Cannabinoid receptor 1
19	9606.ENSP00000218316	0.525	Melatonin-related receptor
20	9606.ENSP00000438085	0.517	ADP-ribosylation factor-binding protein GGA3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.814	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0009987	0.983	cellular process
GO:0050794	0.980	regulation of cellular process
GO:0048856	0.901	anatomical structure development
GO:0032501	0.887	multicellular organismal process
GO:0007275	0.727	multicellular organism development
GO:0050896	0.522	response to stimulus
GO:0048519	0.443	negative regulation of biological process
GO:0048523	0.393	negative regulation of cellular process
GO:0048731	0.388	system development
GO:0007154	0.351	cell communication
GO:0051716	0.350	cellular response to stimulus
GO:0048513	0.340	animal organ development
GO:0007165	0.306	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0030312	0.981	external encapsulating structure
GO:0031012	0.965	extracellular matrix
GO:0016020	0.906	membrane
GO:0005622	0.557	intracellular anatomical structure
GO:0005886	0.503	plasma membrane
GO:0043226	0.458	organelle
GO:0043227	0.350	membrane-bounded organelle
GO:0005737	0.339	cytoplasm
GO:0043229	0.327	intracellular organelle
GO:0043231	0.305	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]