StarFunc result for job id Q8TER5

User Input

>input (1519 residues)
MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLA
KVQQEACAQYSGFLFFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLA
LKCLAPGGGRVQEVPVPNEACAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAE
LICPRFVHKEGLMVGHQPSTLPPELPSGPPGLPSPPLPEEALGTRSPGDGHNAPVEGPEG
EYVELLEVTLPVRGSPTDAEGSPGLSRVRTVPTRKGAGGKGRHRRHRAWMHQKGLGPRGQ
DGARPPGEGSSTGASPESPPGAEAVPEAAVLEVSEPPAEAVGEASGSCPLRPGELRGGGG
GGQGAEGPPGTPRRTGKGNRRKKRAAGRGALSRGGDSAPLSPGDKEDASHQEALGNLPSP
SEHKLPECHLVKEEYEGSGKPESEPKELKTAGEKEPQLSEACGPTEEGAGERELEGPGLL
CMAGHTGPEGPLSDTPTPPLETVQEGKGDNIPEEALAVSVSDHPDVAWDLMASGFLILTG
GVDQSGRALLTITPPCPPEEPPPSRDTLNTTLHYLHSLLRPDLQTLGLSVLLDLRQAPPL
PPALIPALSQLQDSGDPPLVQRLLILIHDDLPTELCGFQGAEVLSENDLKRVAKPEELQW
ELGGHRDPSPSHWVEIHQEVVRLCRLCQGVLGSVRQAIEELEGAAEPEEEEAVGMPKPLQ
KVLADPRLTALQRDGGAILMRLRSTPSSKLEGQGPATLYQEVDEAIHQLVRLSNLHVQQQ
EQRQCLRRLQQVLQWLSGPGEEQLASFAMPGDTLSALQETELRFRAFSAEVQERLAQARE
ALALEENATSQKVLDIFEQRLEQVESGLHRALRLQRFFQQAHEWVDEGFARLAGAGPGRE
AVLAALALRRAPEPSAGTFQEMRALALDLGSPAALREWGRCQARCQELERRIQQHVGEEA
SPRGYRRRRADGASSGGAQWGPRSPSPSLSSLLLPSSPGPRPAPSHCSLAPCGEDYEEEG
PELAPEAEGRPPRAVLIRGLEVTSTEVVDRTCSPREHVLLGRARGPDGPWGVGTPRMERK
RSISAQQRLVSELIACEQDYVATLSEPVPPPGPELTPELRGTWAAALSARERLRSFHRTH
FLRELQGCATHPLRIGACFLRHGDQFSLYAQYVKHRHKLENGLAALSPLSKGSMEAGPYL
PRALQQPLEQLTRYGRLLEELLREAGPELSSECRALGAAVQLLREQEARGRDLLAVEAVR
GCEIDLKEQGQLLHRDPFTVICGRKKCLRHVFLFEHLLLFSKLKGPEGGSEMFVYKQAFK
TADMGLTENIGDSGLCFELWFRRRRAREAYTLQATSPEIKLKWTSSIAQLLWRQAAHNKE
LRVQQMVSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPG
ACSLPARVEEEAWDLDVKQISLAPETLDSSGDVSPGPRNSPSLQPPHPGSSTPTLASRGI
LGLSRQSHARALSDPTTPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TER5	0.999	0.999	0.000	1519	1.000	1.000	Q8TER5.pdb.gz	ARH40_HUMAN Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40 PE=1 SV=3
2	AFDB:A0A2R8QD21	0.259	0.214	2.147E-67	1989	0.295	0.225	A0A2R8QD21.pdb.gz
3	PDB:4mt6A	0.120	0.326	8.361E-11	389	0.040	0.157	4mt6A.pdb.gz
4	PDB:7rx9A	0.094	0.294	3.372E-10	432	0.047	0.167	7rx9A.pdb.gz
5	AFDB:Q6ZNL6	0.091	0.094	9.424E-10	1462	0.117	0.121	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
6	AFDB:Q54DW4	0.117	0.127	9.085E-9	1350	0.090	0.101	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
7	AFDB:Q8IQ97	0.120	0.135	5.460E-7	1311	0.107	0.124	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
8	AFDB:X2JC00	0.132	0.140	1.196E-6	1404	0.099	0.108	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
9	AFDB:Q9TW28	0.137	0.123	2.859E-6	1737	0.055	0.048	Q9TW28.pdb.gz	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
10	AFDB:Q8K1N2	0.068	0.080	5.998E-6	1249	0.118	0.144	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
11	AFDB:Q86SQ0	0.060	0.071	6.544E-6	1253	0.120	0.146	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
12	AFDB:O64728	0.060	0.072	4.451E-5	1218	0.099	0.124	O64728.pdb.gz	STI_ARATH Protein STICHEL OS=Arabidopsis thaliana OX=3702 GN=STI PE=1 SV=2
13	PDB:4gouA	0.085	0.235	2.082E-4	507	0.031	0.093	4gouA.pdb.gz
14	PDB:4mk0A	0.064	0.137	7.368E-4	631	0.022	0.054	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:6u3eA	0.057	0.198	2.190E-3	397	0.030	0.113	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:6bbpA	0.063	0.159	5.468E-3	520	0.028	0.083	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
17	PDB:3uzsA	0.061	0.135	2.406E-2	609	0.023	0.057	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
18	PDB:6nr7A	0.044	0.055	2.992E-2	1086	0.053	0.074	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
19	PDB:3ljuX	0.057	0.209	3.409E-2	373	0.009	0.038	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
20	PDB:7c3mA	0.057	0.120	5.271E-2	577	0.018	0.049	7c3mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TER5	0.0	3012	1519	1.000	1.000	ARH40_HUMAN Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40 PE=1 SV=3
2	Q96PX9	2.32e-83	302	1271	0.116	0.138	PKH4B_HUMAN Pleckstrin homology domain-containing family G member 4B OS=Homo sapiens OX=9606 GN=PLEKHG4B PE=1 SV=4
3	Q58EX7	5.43e-82	297	1191	0.111	0.142	PKHG4_HUMAN Puratrophin-1 OS=Homo sapiens OX=9606 GN=PLEKHG4 PE=1 SV=1
4	Q6DN89	1.70e-80	296	1989	0.093	0.071	Q6DN89_DANRE Quattro OS=Danio rerio OX=7955 GN=sb:cb9 PE=2 SV=1
5	F8VPS6	2.24e-78	286	1181	0.105	0.135	F8VPS6_MOUSE Pleckstrin homology domain containing, family G (with RhoGef domain) member 4 OS=Mus musculus OX=10090 GN=Plekhg4 PE=1 SV=1
6	Q7KU87	9.37e-59	222	872	0.082	0.142	Q7KU87_DROME FI18828p1 OS=Drosophila melanogaster OX=7227 GN=Pura PE=2 SV=1
7	Q86NW6	8.81e-58	222	1191	0.082	0.105	Q86NW6_DROME GM01778p OS=Drosophila melanogaster OX=7227 GN=Pura PE=2 SV=1
8	Q7KU88	1.11e-57	222	1428	0.083	0.088	Q7KU88_DROME Puratrophin-1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=2
9	M9PEF7	1.18e-57	223	1898	0.083	0.066	M9PEF7_DROME Puratrophin-1-like, isoform D OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=1
10	Q7KU89	1.45e-57	223	1904	0.082	0.066	Q7KU89_DROME Puratrophin-1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Pura PE=4 SV=2
11	Q8MSF1	1.07e-39	154	369	0.047	0.192	Q8MSF1_DROME GM23249p OS=Drosophila melanogaster OX=7227 GN=Pura PE=2 SV=1
12	Q6PDM6	4.39e-28	125	1166	0.143	0.186	Q6PDM6_MOUSE Mcf.2 transforming sequence-like OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=1
13	Q63406	5.50e-28	125	1149	0.147	0.195	MCF2L_RAT Guanine nucleotide exchange factor DBS OS=Rattus norvegicus OX=10116 GN=Mcf2l PE=1 SV=3
14	Q64096	8.42e-26	118	1149	0.146	0.193	MCF2L_MOUSE Guanine nucleotide exchange factor DBS OS=Mus musculus OX=10090 GN=Mcf2l PE=1 SV=2
15	O15068	2.65e-25	117	1137	0.141	0.188	MCF2L_HUMAN Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2
16	A0A2R8RHL8	2.43e-23	110	2306	0.058	0.038	A0A2R8RHL8_DANRE Kalirin RhoGEF kinase b OS=Danio rerio OX=7955 GN=wu:fc60a10 PE=4 SV=1
17	P10911	2.84e-23	110	925	0.057	0.094	MCF2_HUMAN Proto-oncogene DBL OS=Homo sapiens OX=9606 GN=MCF2 PE=1 SV=3
18	H7BXZ5	1.11e-22	108	2955	0.073	0.038	H7BXZ5_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=1
19	O60229	1.16e-22	108	2986	0.072	0.037	KALRN_HUMAN Kalirin OS=Homo sapiens OX=9606 GN=KALRN PE=1 SV=3
20	P97924	1.35e-22	108	2959	0.053	0.027	KALRN_RAT Kalirin OS=Rattus norvegicus OX=10116 GN=Kalrn PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18433 DUF5610	1.1e+02	14.7	Domain of unknown function (DUF5610)
2	PF00169 PH	2.1e+02	13.8	PH domain
3	PF15411 PH_10	2.2e+02	13.5	Pleckstrin homology domain
4	PF00621 RhoGEF	9.6e-05	34.2	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298694

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357177	0.791	Rho guanine nucleotide exchange factor 11
2	9606.ENSP00000355026	0.783	Rho guanine nucleotide exchange factor 15
3	9606.ENSP00000364631	0.725	FYVE, RhoGEF and PH domain-containing protein 3
4	9606.ENSP00000380942	0.698	Rho guanine nucleotide exchange factor 12
5	9606.ENSP00000338785	0.679	StAR-related lipid transfer protein 13
6	9606.ENSP00000364277	0.666	FYVE, RhoGEF and PH domain-containing protein 1
7	9606.ENSP00000298815	0.631	Rho GTPase-activating protein 42
8	9606.ENSP00000356033	0.630	T-cell activation Rho GTPase-activating protein
9	9606.ENSP00000420612	0.617	TCDD-inducible poly [ADP-ribose] polymerase
10	9606.ENSP00000435634	0.612	Uncharacterized protein C1orf94
11	9606.ENSP00000331342	0.607	Rab11 family-interacting protein 1
12	9606.ENSP00000387020	0.601	Rho guanine nucleotide exchange factor 33
13	9606.ENSP00000392906	0.590	Pleckstrin homology domain-containing family G member 2
14	9606.ENSP00000442307	0.590	Epithelial cell-transforming sequence 2 oncogene-like
15	9606.ENSP00000328083	0.589	Rho guanine nucleotide exchange factor 37
16	9606.ENSP00000375649	0.589	Myeloid associated differentiation marker
17	9606.ENSP00000315630	0.571	Switch-associated protein 70
18	9606.ENSP00000304060	0.557	Olfactory receptor 8J1
19	9606.ENSP00000439625	0.555	Pleckstrin homology domain-containing family G member 5
20	9606.ENSP00000354837	0.553	Rho guanine nucleotide exchange factor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0009966	0.992	regulation of signal transduction
GO:1902531	0.960	regulation of intracellular signal transduction
GO:0051056	0.946	regulation of small GTPase mediated signal transduction
GO:0009987	0.384	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0043226	0.727	organelle
GO:0043227	0.346	membrane-bounded organelle
GO:0043229	0.315	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]