StarFunc result for job id Q8TES7

User Input

>input (1133 residues)
MAPKTKKGCKVTLPEKPVKLASHTRDTTGVSQMFPSSKARTKSLLGDDVFSTMAGLEEAD
AEVSGISEADPQALLQAMKDLDGMDADILGLKKSNSAPSKKAAKDPGKGELPNHPKPAGG
AIPTKKSLPSPSSSGHQNRRFSSEDLEDPLRGLLSYDEGGITKQPPVTQSKTASDKSPST
VRDQGPSIPLTPGDTPIRKKEELLFDDGDDIMATLGFGDSPKAEKRQIGDQEGPRPARST
LDELLGRGMATKLLARPGTGEHREFKLDKKYQRPQDSEDMWGDEDFTFGAYQPTVVSSEG
RQSRRQSVSRFFADSGADPKGEPGSKQSPPMASSPIQPRKGGADWLGLKDEDLDLFPASP
TREAHRESSVPVTPSVPPPASQHSTPAGLPPSRAKPPTEGAGSPAKASQASKLRASKEEK
EDWLSHALSRKKSQGLAREQHAGTSEGLHLAGTAGHPPSGSQPLTSTQGLEHAAAGGSSG
TTARERPCVRPGVSGSPVTQNHAASALPTGSPKRGTAPGDLSATEPATCFPSTQKPTEPS
VPVQPLLPESLARSLLPSTEYQKQLLAAQVQLQCSPAELQAELLHSQARLAELEAQVRKL
ELERAQHELLLGSLQQQHQADLELIESAHRSRIKVLETSYQQREERLRRENEELSARYLS
QCQEAEQARAELTAQHQRRLAAIAQEKDQEMERLRELQRASILDMRRDHEEQLQRLKLLK
DREVDAATSATSHTRSLNSIIHQMEKFSSSLHELSSRVEASHLTTSQERELGIRQRDEQL
RALQERLGQQQRDMEEERSRQQEVIGKMEARLNEQSRLLEQERWRVTAEQSKAESMQRAL
EEQRKVTAQQMAMERAELERAKSALLEEQKSVMLKCGEERRRLAAEWAEFSAQQKLSKER
AEREAERALQVDTQREGTLISLAKQAELKIRASELRAEEKQLAAERAALEQERQELRLEK
ERINATALRVKLRAEEVESMSKVASEKYEEGERALREAQQVQAEQQARLQAVQQQQERLR
KQEQHMHQEHLSLAQQRLQLDRARQDLPSSLVGLFPRAQGPAASSQSALMPPAPTTRWCS
QPPTGLDPSPLHLHARLALLRHMAEQDRDFLENEQFFLETLKKGSYNLTSHSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TES7	1.000	1.000	0.000	1133	1.000	1.000	Q8TES7.pdb.gz	FBF1_HUMAN Fas-binding factor 1 OS=Homo sapiens OX=9606 GN=FBF1 PE=1 SV=2
2	AFDB:A2A870	0.256	0.250	2.703E-94	1173	0.670	0.647	A2A870.pdb.gz	FBF1_MOUSE Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1
3	AFDB:Q5DU05	0.113	0.092	2.088E-11	1446	0.169	0.133	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
4	AFDB:B9EKI3	0.090	0.094	1.710E-10	1091	0.169	0.176	B9EKI3.pdb.gz	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
5	AFDB:U3JAG9	0.137	0.139	8.429E-10	1113	0.166	0.169	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
6	AFDB:Q62036	0.116	0.122	2.012E-9	1060	0.158	0.169	Q62036.pdb.gz	CP131_MOUSE Centrosomal protein of 131 kDa OS=Mus musculus OX=10090 GN=Cep131 PE=1 SV=2
7	AFDB:Q9UPN4	0.090	0.094	1.326E-8	1083	0.169	0.177	Q9UPN4.pdb.gz	CP131_HUMAN Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=3
8	AFDB:Q0VF96	0.115	0.105	2.944E-8	1302	0.174	0.151	Q0VF96.pdb.gz	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
9	AFDB:I3L2J8	0.144	0.152	1.451E-7	1047	0.167	0.181	I3L2J8.pdb.gz	I3L2J8_HUMAN Centrosomal protein 131 OS=Homo sapiens OX=9606 GN=CEP131 PE=1 SV=1
10	AFDB:Q5TB80	0.063	0.052	2.085E-7	1403	0.173	0.140	Q5TB80.pdb.gz	CE162_HUMAN Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2
11	PDB:7wtwt	0.035	0.275	7.556	108	0.011	0.120	7wtwt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4J2E4	0.0	2163	1092	0.962	0.998	A0A0R4J2E4_HUMAN Fas binding factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=FBF1 PE=1 SV=2
2	A2A870	0.0	1335	1173	0.671	0.648	FBF1_MOUSE Fas-binding factor 1 OS=Mus musculus OX=10090 GN=Fbf1 PE=1 SV=1
3	Q8TES7	0.0	2261	1133	1.000	1.000	FBF1_HUMAN Fas-binding factor 1 OS=Homo sapiens OX=9606 GN=FBF1 PE=1 SV=2
4	Q9VTN6	6.62e-13	75.9	928	0.098	0.120	Q9VTN6_DROME Twitchy OS=Drosophila melanogaster OX=7227 GN=twy PE=4 SV=1
5	Q9XWN2	1.33e-08	61.2	534	0.061	0.129	Q9XWN2_CAEEL Centrosomal protein of 162 kDa OS=Caenorhabditis elegans OX=6239 GN=dyf-19 PE=4 SV=2
6	Q6AW69	2.01e-04	48.1	1297	0.094	0.082	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
7	Q586A8	0.005	43.5	797	0.064	0.092	Q586A8_TRYB2 Trichohyalin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.200 PE=4 SV=1
8	Q7Z6P3	0.016	42.0	1021	0.042	0.047	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
9	D3ZUD5	0.059	40.0	1027	0.078	0.086	D3ZUD5_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=1 SV=2
10	A0A8I6AA62	0.074	39.7	1036	0.078	0.085	A0A8I6AA62_RAT OFD1, centriole and centriolar satellite protein OS=Rattus norvegicus OX=10116 GN=Ofd1 PE=4 SV=1
11	Q9P2B4	0.079	39.7	639	0.051	0.091	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
12	Q5HZI1	0.13	38.9	1210	0.057	0.054	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
13	Q8N137	0.14	38.9	903	0.072	0.091	CNTRB_HUMAN Centrobin OS=Homo sapiens OX=9606 GN=CNTROB PE=1 SV=1
14	Q9W179	0.26	38.1	1703	0.072	0.048	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
15	Q0VF96	0.38	37.4	1302	0.091	0.079	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
16	B7YZQ1	0.48	37.0	1635	0.072	0.050	B7YZQ1_DROME Sterile20-like kinase, isoform F OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=1
17	Q99LJ0	0.74	36.2	638	0.049	0.088	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
18	E9Q9R9	1.3	35.8	1921	0.079	0.046	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
19	G3I183	1.3	35.4	957	0.072	0.086	G3I183_CRIGR Oral-facial-digital syndrome 1 protein-like OS=Cricetulus griseus OX=10029 GN=I79_017133 PE=1 SV=1
20	Q0E8J3	1.9	35.4	3640	0.064	0.020	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281142	0.993	Sodium channel and clathrin linker 1
2	9606.ENSP00000278935	0.990	Centrosomal protein of 164 kDa
3	9606.ENSP00000380911	0.987	Centrosomal protein of 83 kDa
4	9606.ENSP00000306105	0.960	Centrosomal protein of 89 kDa
5	9606.ENSP00000371472	0.821	Ninein
6	9606.ENSP00000308275	0.819	Mitochondrial ribosomal protein L38
7	9606.ENSP00000362424	0.761	TRAF3-interacting protein 1
8	9606.ENSP00000334379	0.746	C2 domain-containing protein 3
9	9606.ENSP00000267890	0.739	Tau-tubulin kinase 2
10	9606.ENSP00000385215	0.737	Centrosomal protein of 162 kDa
11	9606.ENSP00000383421	0.704	Splicing regulator RBM11
12	9606.ENSP00000403453	0.699	Outer dense fiber protein 2
13	9606.ENSP00000263776	0.692	1-aminocyclopropane-1-carboxylate synthase-like protein 1
14	9606.ENSP00000370803	0.692	Centriolar coiled-coil protein of 110 kDa
15	9606.ENSP00000219481	0.690	Peroxisomal 2,4-dienoyl-CoA reductase
16	9606.ENSP00000359376	0.689	Solute carrier family 17 member 9
17	9606.ENSP00000410216	0.688	Centrosomal protein POC5
18	9606.ENSP00000387209	0.680	Centrosomal protein of 19 kDa
19	9606.ENSP00000356579	0.670	Centrosome-associated protein 350
20	9606.ENSP00000328133	0.666	Interleukin-20 receptor subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0070925	0.970	organelle assembly
GO:0044782	0.968	cilium organization
GO:0060271	0.962	cilium assembly
GO:0045216	0.787	cell-cell junction organization
GO:0007043	0.781	cell-cell junction assembly
GO:0007163	0.759	establishment or maintenance of cell polarity
GO:0030010	0.706	establishment of cell polarity
GO:0090162	0.681	establishment of epithelial cell polarity
GO:0043297	0.681	apical junction assembly
GO:0065007	0.377	biological regulation
GO:0050794	0.342	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	0.997	centrosome
GO:0005829	0.982	cytosol
GO:0043227	0.962	membrane-bounded organelle
GO:0005814	0.935	centriole
GO:0032991	0.904	protein-containing complex
GO:0120025	0.901	plasma membrane bounded cell projection
GO:0005929	0.868	cilium
GO:0043231	0.713	intracellular membrane-bounded organelle
GO:0005819	0.702	spindle
GO:0099080	0.697	supramolecular complex
GO:0140535	0.692	intracellular protein-containing complex
GO:0000922	0.683	spindle pole
GO:0030054	0.630	cell junction
GO:0097539	0.614	ciliary transition fiber
GO:0099512	0.603	supramolecular fiber
GO:0099513	0.579	polymeric cytoskeletal fiber
GO:0070161	0.496	anchoring junction
GO:0005911	0.479	cell-cell junction
GO:0043296	0.371	apical junction complex
GO:0045095	0.370	keratin filament
GO:0070013	0.345	intracellular organelle lumen
GO:0031981	0.339	nuclear lumen
GO:0005654	0.312	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]