StarFunc result for job id Q8TEU7

User Input

>input (1601 residues)
MNSPVDPGARQALRKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSG
NQVLFCSETIARCWYILLSGSVLVKGSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
AKDNEDSILQREIPARQSRRRFRKINYKGERQTITDDVEVNSYLSLPADLTKMHLTENPH
PQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
DRTDPLQGRDLVRECLEKEPADKTDDDIEQLLEFMHQLPAFANMTMSVRRELCSVMIFEV
VEQAGAIILEDGQELDSWYVILNGTVEISHPDGKVENLFMGNSFGITPTLDKQYMHGIVR
TKVDDCQFVCIAQQDYWRILNHVEKNTHKVEEEGEIVMVHEHRELDRSGTRKGHIVIKAT
PERLIMHLIEEHSIVDPTYIEDFLLTYRTFLESPLDVGIKLLEWFKIDSLRDKVTRIVLL
WVNNHFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRES
PLQFSLNGGSEKGFGIFVEGVEPGSKAADSGLKRGDQIMEVNGQNFENITFMKAVEILRN
NTHLALTVKTNIFVFKELLFRTEQEKSGVPHIPKIAEKKSNRHSIQHVPGDIEQTSQEKG
SKKVKANTVSGGRNKIRKILDKTRFSILPPKLFSDGGLSQSQDDSIVGTRHCRHSLAIMP
IPGTLSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKVDQQSCYIIISKDTTAKEVVFHA
VHEFGLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGRYYLKNNMETETLC
SDEDAQELVKESQLSMLQLSTIEVATQLSMRDFDLFRNIEPTEYIDDLFKLNSKTGNTHL
KRFEDIVNQETFWVASEILTEANQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLA
SVARLRGTWEKLPSKYEKHLQDLQDIFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDM
TFLHEGNDSKVDGLVNFEKLRMISKEIRQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLD
VQGGAHKKRARRSSLLNAKKLYEDAQMARKVKQYLSSLDVETDEEKFQMMSLQWEPAYGT
LTKNLSEKRSAKSSEMSPVPMRSAGQTTKAHLHQPHRVSQVLQVPAVNLHPIRKKGQTKD
PALNTSLPQKVLGTTEEISGKKHTEDTISVASSLHSSPPASPQGSPHKGYTLIPSAKSDN
LSDSSHSEISSRSSIVSNCSVDSMSAALQDERCSSQALAVPESTGALEKTEHASGIGDHS
QHGPGWTLLKPSLIKCLAVSSSVSNEEISQEHIIIEAADSGRGSWTSCSSSSHDNFQSLP
NPKSWDFLNSYRHTHLDDPIAEVEPTDSEPYSCSKSCSRTCGQCKGSLERKSWTSSSSLS
DTYEPNYGTVKQRVLESTPAESSEGLDPKDATDPVYKTVTSSTEKGLIVYCVTSPKKDDR
YREPPPTPPGYLGISLADLKEGPHTHLKPPDYSVAVQRSKMMHNSLSRLPPASLSSNLVA
CVPSKIVTQPQRHNLQPFHPKLGDVTDADSEADENEQVSAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEU7	1.000	1.000	0.000	1601	1.000	1.000	Q8TEU7.pdb.gz	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
2	AFDB:Q9Y4G8	0.517	0.549	0.000	1499	0.596	0.636	Q9Y4G8.pdb.gz	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
3	AFDB:G5EDB9	0.508	0.550	6.316E-89	1470	0.304	0.331	G5EDB9.pdb.gz	RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
4	AFDB:Q9VMF3	0.460	0.467	1.366E-88	1573	0.315	0.321	Q9VMF3.pdb.gz	Q9VMF3_DROME Dizzy isoform AII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=2
5	PDB:4f7zA	0.307	0.490	7.541E-38	946	0.144	0.244	4f7zA.pdb.gz
6	PDB:2byvE	0.352	0.586	4.229E-37	922	0.147	0.256	2byvE.pdb.gz
7	AFDB:Q9N5D3	0.207	0.221	1.047E-12	1493	0.128	0.137	Q9N5D3.pdb.gz	SOS_CAEEL Son of sevenless homolog OS=Caenorhabditis elegans OX=6239 GN=sos-1 PE=1 SV=3
8	PDB:5dykA	0.070	0.131	5.024E-10	809	0.036	0.072	5dykA.pdb.gz
9	PDB:3j4qB	0.070	0.273	4.287E-8	382	0.026	0.110	3j4qB.pdb.gz
10	PDB:6byrB	0.066	0.325	7.390E-8	288	0.023	0.128	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
11	PDB:4dinB	0.069	0.286	2.404E-7	345	0.026	0.122	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
12	AFDB:Q5SYB0	0.059	0.059	5.010E-6	1578	0.092	0.093	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
13	AFDB:A0A0B4K6Y7	0.063	0.048	8.636E-6	2395	0.107	0.072	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
14	AFDB:Q8R4H2	0.071	0.073	1.242E-5	1543	0.079	0.082	Q8R4H2.pdb.gz	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
15	PDB:7n15A	0.070	0.202	3.086E-5	520	0.017	0.054	7n15A.pdb.gz	Structural and functional characterization of an achromatopsia-associated mutation in a phototransduction channel.
16	PDB:4avaA	0.061	0.271	7.647E-5	327	0.021	0.101	4avaA.pdb.gz	Cyclic AMP Regulation of Protein Lysine Acetylation in Mycobacterium Tuberculosis.
17	AFDB:A0A1D5NS76	0.055	0.046	9.141E-5	2005	0.100	0.080	A0A1D5NS76.pdb.gz
18	PDB:7wswA	0.071	0.225	9.169E-5	472	0.015	0.051	7wswA.pdb.gz
19	PDB:4byyA	0.067	0.430	9.595E-5	226	0.013	0.093	4byyA.pdb.gz
20	AFDB:G5ECZ8	0.074	0.052	1.047E-4	2422	0.143	0.095	G5ECZ8.pdb.gz	G5ECZ8_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mpz-1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y661	0.0	1753	1559	0.611	0.627	A0A2R8Y661_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
2	A0A2R8YGD3	0.0	1901	1679	0.660	0.630	A0A2R8YGD3_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
3	A0A5F9ZHG7	0.0	2560	1267	0.771	0.975	A0A5F9ZHG7_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=4 SV=1
4	E9PCH4	0.0	3276	1651	0.986	0.956	E9PCH4_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 PE=4 SV=1
5	F1M386	0.0	1714	1496	0.596	0.638	RPGF2_RAT Rap guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Rapgef2 PE=1 SV=2
6	F1MSG6	0.0	1701	1486	0.590	0.636	RPGF2_BOVIN Rap guanine nucleotide exchange factor 2 OS=Bos taurus OX=9913 GN=RAPGEF2 PE=1 SV=2
7	F1PBJ0	0.0	1721	1498	0.594	0.635	RPGF2_CANLF Rap guanine nucleotide exchange factor 2 OS=Canis lupus familiaris OX=9615 GN=RAPGEF2 PE=1 SV=2
8	G5ECB8	0.0	650	1146	0.234	0.327	G5ECB8_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
9	G5ECE2	0.0	651	1188	0.235	0.316	G5ECE2_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
10	G5EDB9	0.0	653	1470	0.238	0.259	RPGF_CAEEL Rap guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
11	G5EEE0	0.0	654	1305	0.238	0.292	G5EEE0_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
12	Q17RH5	0.0	1726	1486	0.597	0.643	Q17RH5_HUMAN RAPGEF2 protein OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
13	Q8CHG7	0.0	1712	1496	0.596	0.638	RPGF2_MOUSE Rap guanine nucleotide exchange factor 2 OS=Mus musculus OX=10090 GN=Rapgef2 PE=1 SV=2
14	Q8TEU7	0.0	3329	1601	1.000	1.000	RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6 PE=1 SV=2
15	Q9Y4G8	0.0	1729	1499	0.598	0.638	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
16	B7Z026	1.11e-134	456	1422	0.145	0.163	B7Z026_DROME Dizzy isoform CII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=1
17	B7Z025	7.45e-134	456	1569	0.145	0.148	B7Z025_DROME Dizzy isoform BII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=1
18	Q9VMF3	1.17e-133	456	1573	0.145	0.147	Q9VMF3_DROME Dizzy isoform AII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=2
19	Q95V18	2.30e-133	455	1573	0.145	0.147	Q95V18_DROME Guanine nucleotide exchange factor OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=2 SV=1
20	Q7K3Z6	1.92e-43	174	861	0.062	0.115	Q7K3Z6_DROME Exchange protein directly activated by cAMP, isoform D OS=Drosophila melanogaster OX=7227 GN=Epac PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	4.3e-08	44.5	Cyclic nucleotide-binding domain
2	PF00595 PDZ	6.3e-11	53.8	PDZ domain
3	PF13180 PDZ_2	1e+02	14.7	PDZ domain
4	PF17820 PDZ_6	4.3e-05	34.6	PDZ domain
5	PF02163 Peptidase_M50	0.0099	26.8	Peptidase family M50
6	PF00788 RA	2.6e-08	45.7	Ras association (RalGDS/AF-6) domain
7	PF00617 RasGEF	4.5e-49	178.6	RasGEF domain
8	PF00618 RasGEF_N	5.9e-09	47.5	RasGEF N-terminal motif
9	PF07202 Tcp10_C	70	14.5	T-complex protein 10 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296859

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358723	0.986	Ras-related protein Rap-1A
2	9606.ENSP00000394794	0.981	Tyrosine-protein phosphatase non-receptor type 13
3	9606.ENSP00000357005	0.979	Junctional adhesion molecule A
4	9606.ENSP00000250559	0.941	Ras-related protein Rap-1b
5	9606.ENSP00000289104	0.897	Ras-related protein M-Ras
6	9606.ENSP00000245304	0.859	Ras-related protein Rap-2a
7	9606.ENSP00000375960	0.849	Afadin
8	9606.ENSP00000385450	0.829	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
9	9606.ENSP00000304604	0.814	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
10	9606.ENSP00000264431	0.809	Rap guanine nucleotide exchange factor 2
11	9606.ENSP00000346151	0.805	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2
12	9606.ENSP00000426948	0.800	Uncharacterized protein
13	9606.ENSP00000344456	0.794	Catenin beta-1
14	9606.ENSP00000358081	0.715	BAG family molecular chaperone regulator 3
15	9606.ENSP00000427421	0.630	CDC42 small effector protein 2
16	9606.ENSP00000438042	0.570	Sphingomyelin synthase-related protein 1
17	9606.ENSP00000369695	0.563	Protein AF-9
18	9606.ENSP00000439479	0.548	DmX-like protein 1
19	9606.ENSP00000424827	0.525	E3 ubiquitin-protein ligase NEDD4
20	9606.ENSP00000368566	0.520	Long-chain-fatty-acid--CoA ligase 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0005085	0.994	guanyl-nucleotide exchange factor activity
GO:0019899	0.977	enzyme binding
GO:0031267	0.973	small GTPase binding
GO:0043168	0.965	anion binding
GO:0005543	0.913	phospholipid binding
GO:0070300	0.892	phosphatidic acid binding
GO:0030742	0.824	GTP-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.980	cellular process
GO:0016043	0.961	cellular component organization
GO:0043547	0.946	positive regulation of GTPase activity
GO:1990778	0.944	protein localization to cell periphery
GO:0072657	0.940	protein localization to membrane
GO:0050789	0.939	regulation of biological process
GO:0050794	0.933	regulation of cellular process
GO:0072659	0.846	protein localization to plasma membrane
GO:0051716	0.801	cellular response to stimulus
GO:0007154	0.744	cell communication
GO:0023052	0.736	signaling
GO:0007165	0.734	signal transduction
GO:0022607	0.726	cellular component assembly
GO:0030030	0.721	cell projection organization
GO:0048518	0.675	positive regulation of biological process
GO:0048522	0.580	positive regulation of cellular process
GO:0048856	0.557	anatomical structure development
GO:0030031	0.554	cell projection assembly
GO:0120036	0.468	plasma membrane bounded cell projection organization
GO:0009966	0.456	regulation of signal transduction
GO:0019222	0.447	regulation of metabolic process
GO:0060255	0.406	regulation of macromolecule metabolic process
GO:0031323	0.406	regulation of cellular metabolic process
GO:0080090	0.391	regulation of primary metabolic process
GO:0051171	0.389	regulation of nitrogen compound metabolic process
GO:0009893	0.332	positive regulation of metabolic process
GO:0032501	0.330	multicellular organismal process
GO:0031399	0.317	regulation of protein modification process
GO:0048519	0.307	negative regulation of biological process
GO:0120031	0.306	plasma membrane bounded cell projection assembly
GO:1902531	0.300	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.998	intracellular organelle
GO:0005886	0.993	plasma membrane
GO:0043228	0.986	non-membrane-bounded organelle
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0005856	0.809	cytoskeleton
GO:0043227	0.797	membrane-bounded organelle
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0015630	0.750	microtubule cytoskeleton
GO:0005815	0.591	microtubule organizing center
GO:0005813	0.565	centrosome
GO:0031982	0.479	vesicle
GO:0098590	0.414	plasma membrane region
GO:0016324	0.371	apical plasma membrane
GO:0031410	0.314	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]