StarFunc result for job id Q8TEU8

User Input

>input (576 residues)
MWAPRCRRFWSRWEQVAALLLLLLLLGVPPRSLALPPIRYSHAGICPNDMNPNLWVDAQS
TCRRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEATCDHFMCLQQG
SECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFT
WPNTSPPPPETTMHPTTASPETPELDMAAPALLNNPVHQSVTMGETVSFLCDVVGRPRPE
ITWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNAQLQDAGIYTCTARNVAGVLRADF
PLSVVRGHQAAATSESSPNGTAFPAAECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGH
CHRNLNHFETYEACMLACMSGPLAACSLPALQGPCKAYAPRWAYNSQTGQCQSFVYGGCE
GNGNNFESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGR
ALVTVDEVLKDEKMGLKFLGQEPLEVTLLHVDWACPCPNVTVSEMPLIIMGEVDGGMAML
RPDSFVGASSARRVRKLREVMHKKTCDVLKEFLGLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEU8	1.000	1.000	0.000	576	1.000	1.000	Q8TEU8.pdb.gz	WFKN2_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=WFIKKN2 PE=1 SV=1
2	AFDB:Q96NZ8	0.395	0.409	1.014E-72	548	0.542	0.569	Q96NZ8.pdb.gz	WFKN1_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WFIKKN1 PE=1 SV=1
3	AFDB:Q8R0S6	0.401	0.414	1.079E-70	552	0.533	0.556	Q8R0S6.pdb.gz	WFKN1_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Mus musculus OX=10090 GN=Wfikkn1 PE=2 SV=2
4	AFDB:Q5STE3	0.131	0.092	6.092E-12	841	0.156	0.107	Q5STE3.pdb.gz	FSTL4_MOUSE Follistatin-related protein 4 OS=Mus musculus OX=10090 GN=Fstl4 PE=2 SV=1
5	AFDB:P02760	0.119	0.179	8.097E-12	352	0.094	0.153	P02760.pdb.gz	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
6	AFDB:Q07456	0.117	0.179	6.282E-11	349	0.106	0.175	Q07456.pdb.gz	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
7	AFDB:O76840	0.127	0.040	6.650E-11	2167	0.127	0.034	O76840.pdb.gz	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
8	AFDB:B3DKP8	0.151	0.168	8.839E-11	501	0.113	0.130	B3DKP8.pdb.gz
9	AFDB:Q64240	0.117	0.179	9.357E-11	349	0.104	0.172	Q64240.pdb.gz	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
10	AFDB:G5EBF1	0.161	0.075	2.759E-10	1273	0.109	0.049	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
11	PDB:4bd9B	0.114	0.334	5.248E-10	165	0.073	0.255	4bd9B.pdb.gz	A Noncanonical Mechanism of Carboxypeptidase Inhibition Revealed by the Crystal Structure of the Tri-Kunitz Smci in Complex with Human Cpa4.
12	PDB:6feyB	0.162	0.434	1.105E-7	207	0.061	0.169	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
13	PDB:6dlfA	0.144	0.344	6.450E-7	236	0.038	0.093	6dlfA.pdb.gz
14	PDB:6feyD	0.149	0.514	1.206E-6	160	0.050	0.181	6feyD.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
15	PDB:5hhmI	0.142	0.366	1.431E-6	196	0.040	0.117	5hhmI.pdb.gz	Molecular basis for universal HLA-A*0201-restricted CD8+ T-cell immunity against influenza viruses.
16	PDB:1ueaB	0.162	0.466	5.298E-6	181	0.038	0.122	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
17	PDB:6sm1A	0.137	0.596	5.937E-6	111	0.033	0.171	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
18	PDB:1cd0A	0.145	0.648	8.842E-6	111	0.036	0.189	1cd0A.pdb.gz
19	PDB:1ct8A	0.148	0.359	1.175E-5	214	0.049	0.131	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
20	PDB:2cd0A	0.144	0.640	1.175E-5	111	0.038	0.198	2cd0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7TQN3	0.0	1079	571	0.915	0.923	WFKN2_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Mus musculus OX=10090 GN=Wfikkn2 PE=1 SV=2
2	Q8R0S6	0.0	586	552	0.536	0.560	WFKN1_MOUSE WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Mus musculus OX=10090 GN=Wfikkn1 PE=2 SV=2
3	Q8TEU8	0.0	1199	576	1.000	1.000	WFKN2_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 OS=Homo sapiens OX=9606 GN=WFIKKN2 PE=1 SV=1
4	Q96NZ8	0.0	585	548	0.528	0.555	WFKN1_HUMAN WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WFIKKN1 PE=1 SV=1
5	Q07456	5.15e-23	102	349	0.094	0.155	AMBP_MOUSE Protein AMBP OS=Mus musculus OX=10090 GN=Ambp PE=1 SV=2
6	Q64240	4.72e-22	100	349	0.089	0.146	AMBP_RAT Protein AMBP OS=Rattus norvegicus OX=10116 GN=Ambp PE=1 SV=1
7	P86733	2.04e-21	92.0	126	0.082	0.373	KCP_HALAI BPTI/Kunitz domain-containing protein (Fragment) OS=Haliotis asinina OX=109174 PE=1 SV=1
8	P02760	3.60e-20	94.4	352	0.087	0.142	AMBP_HUMAN Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1
9	P84875	1.52e-18	85.5	165	0.068	0.236	PCPI_SABMA Carboxypeptidase inhibitor SmCI OS=Sabellastarte magnifica OX=389514 PE=1 SV=1
10	O76840	5.39e-18	90.9	2167	0.076	0.020	PPN1_CAEEL Papilin OS=Caenorhabditis elegans OX=6239 GN=mig-6 PE=1 SV=1
11	Q868Z9	2.08e-16	85.9	2898	0.080	0.016	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
12	Q1WCN6	6.37e-16	79.7	233	0.069	0.172	Q1WCN6_DANRE Tissue factor pathway inhibitor OS=Danio rerio OX=7955 GN=si:ch211-262k23.2 PE=2 SV=1
13	O54819	2.35e-15	79.3	306	0.075	0.141	TFPI1_MOUSE Tissue factor pathway inhibitor OS=Mus musculus OX=10090 GN=Tfpi PE=2 SV=1
14	Q02445	8.25e-15	77.8	302	0.066	0.126	TFPI1_RAT Tissue factor pathway inhibitor OS=Rattus norvegicus OX=10116 GN=Tfpi PE=2 SV=1
15	O43291	1.02e-14	76.6	252	0.099	0.226	SPIT2_HUMAN Kunitz-type protease inhibitor 2 OS=Homo sapiens OX=9606 GN=SPINT2 PE=1 SV=2
16	B2G331	1.00e-13	68.6	78	0.049	0.359	VKT2B_HETCR TauPI-stichotoxin-Hcr2b OS=Heteractis crispa OX=175771 PE=1 SV=1
17	D8KY58	1.58e-13	68.2	82	0.045	0.317	VKT_BOMTE Kunitz-type serine protease inhibitor Bt-KTI OS=Bombus terrestris OX=30195 PE=2 SV=1
18	P10646	1.84e-13	73.6	304	0.073	0.138	TFPI1_HUMAN Tissue factor pathway inhibitor OS=Homo sapiens OX=9606 GN=TFPI PE=1 SV=1
19	P0C8W3	3.69e-13	67.4	88	0.043	0.284	VKT11_HOFGE Kunitz-type serine protease inhibitor Hg1 OS=Hoffmannihadrurus gertschi OX=380989 PE=1 SV=1
20	F6QKA3	6.72e-13	71.2	250	0.069	0.160	F6QKA3_RAT Serine peptidase inhibitor, Kunitz type, 2 OS=Rattus norvegicus OX=10116 GN=Spint2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	2.1e-12	58.3	Immunoglobulin I-set domain
2	PF00047 ig	0.0018	29.7	Immunoglobulin domain
3	PF13895 Ig_2	3.8e-05	35.2	Immunoglobulin domain
4	PF13927 Ig_3	4.4e-10	51.3	Immunoglobulin domain
5	PF07648 Kazal_2	22	16.6	Kazal-type serine protease inhibitor domain
6	PF00014 Kunitz_BPTI	3.8e-27	105.6	Kunitz/Bovine pancreatic trypsin inhibitor domain
7	PF01759 NTR	9.5e-06	36.8	UNC-6/NTR/C345C module
8	PF07686 V-set	0.45	22.1	Immunoglobulin V-set domain
9	PF00095 WAP	1.6e-05	36.5	WAP-type (Whey Acidic Protein) 'four-disulfide core'

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311184

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257868	0.871	Growth/differentiation factor 11
2	9606.ENSP00000260950	0.865	Growth/differentiation factor 8
3	9606.ENSP00000359532	0.738	Neurotensin receptor type 1
4	9606.ENSP00000361413	0.738	Fibrinogen C domain-containing protein 1
5	9606.ENSP00000166139	0.690	Follistatin-related protein 3
6	9606.ENSP00000317817	0.678	SH2 domain-containing protein 3C
7	9606.ENSP00000256759	0.663	Follistatin
8	9606.ENSP00000437464	0.624	F-box/LRR-repeat protein 17
9	9606.ENSP00000356301	0.609	Transmembrane protein 9
10	9606.ENSP00000367316	0.608	Integrin alpha-8
11	9606.ENSP00000423673	0.597	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
12	9606.ENSP00000424497	0.590	Putative E3 ubiquitin-protein ligase SH3RF2
13	9606.ENSP00000362759	0.534	Adhesion G protein-coupled receptor B2
14	9606.ENSP00000368104	0.517	Bone morphogenetic protein 2
15	9606.ENSP00000282701	0.510	Bone morphogenetic protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030545	0.993	signaling receptor regulator activity
GO:0005102	0.992	signaling receptor binding
GO:0140678	0.985	molecular function inhibitor activity
GO:0030547	0.983	signaling receptor inhibitor activity
GO:0050431	0.980	transforming growth factor beta binding
GO:0048019	0.769	receptor antagonist activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.978	cellular process
GO:0048583	0.919	regulation of response to stimulus
GO:0090092	0.911	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0017015	0.902	regulation of transforming growth factor beta receptor signaling pathway
GO:0048519	0.872	negative regulation of biological process
GO:0048523	0.832	negative regulation of cellular process
GO:0090101	0.788	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032502	0.734	developmental process
GO:0048856	0.681	anatomical structure development
GO:0032501	0.661	multicellular organismal process
GO:0050896	0.629	response to stimulus
GO:0030512	0.629	negative regulation of transforming growth factor beta receptor signaling pathway
GO:0007154	0.544	cell communication
GO:0023052	0.543	signaling
GO:0051716	0.542	cellular response to stimulus
GO:0007165	0.534	signal transduction
GO:0007275	0.495	multicellular organism development
GO:0048731	0.387	system development
GO:0048518	0.351	positive regulation of biological process
GO:0019222	0.307	regulation of metabolic process
GO:0060255	0.301	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043227	0.546	membrane-bounded organelle
GO:0005622	0.317	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]