StarFunc result for job id Q8TEV9

User Input

>input (937 residues)
MISAPDVVAFTKEEEYEEEPYNEPALPEEYSVPLFPFASQGANPWSKLSGAKFSRDFILI
SEFSEQVGPQPLLTIPNDTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGSAYPKLNFVED
SKVVLGDSKEGAFAYVHHLTLYDLEARGFVRPFCMAYISADQHKIMQQFQELSAEFSRAS
ECLKTGNRKAFAGELEKKLKDLDYTRTVLHTETEIQKKANDKGFYSSQAIEKANELASVE
KSIIEHQDLLKQIRSYPHRKLKGHDLCPGEMEHIQDQASQASTTSNPDESADTDLYTCRP
AYTPKLIKAKSTKCFDKKLKTLEELCDTEYFTQTLAQLSHIEHMFRGDLCYLLTSQIDRA
LLKQQHITNFLFEDFVEVDDRMVEKQESIPSKPSQDRPPSSSLEECPIPKVLISVGSYKS
SVESVLIKMEQELGDEEYKEVEVTELSSFDPQENLDYLDMDMKGSISSGESIEVLGTEKS
TSVLSKSDSQASLTVPLSPQVVRSKAVSHRTISEDSIEVLSTCPSEALIPDDFKASYPSA
INEEESYPDGNEGAIRFQASISPPELGETEEGSIENTPSQIDSSCCIGKESDGQLVLPST
PAHTHSDEDGVVSSPPQRHRQKDQGFRVDFSVENANPSSRDNSCEGFPAYELDPSHLLAS
RDISKTSLDNYSDTTSYVSSVASTSSDRIPSAYPAGLSSDRHKKRAGQNALKFIRQYPFA
HPAIYSLLSGRTLVVLGEDEAIVRKLVTALAIFVPSYGCYAKPVKHWASSPLHIMDFQKW
KLIGLQRVASPAGAGTLHALSRYSRYTSILDLDNKTLRCPLYRGTLVPRLADHRTQIKRG
STYYLHVQSMLTQLCSKAFLYTFCHHLHLPTHDKETEELVASRQMSFLKLTLGLVNEDVR
VVQYLAELLKLHYMQESPGTSHPMLRFDYVPSFLYKI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UMB5	0.625	0.627	0.000	935	0.896	0.898	Q3UMB5.pdb.gz	SMCR8_MOUSE Guanine nucleotide exchange protein SMCR8 OS=Mus musculus OX=10090 GN=Smcr8 PE=1 SV=2
2	AFDB:Q8TEV9	1.000	1.000	0.000	937	1.000	1.000	Q8TEV9.pdb.gz	SMCR8_HUMAN Guanine nucleotide exchange protein SMCR8 OS=Homo sapiens OX=9606 GN=SMCR8 PE=1 SV=2
3	PDB:7mgeB	0.382	0.748	5.154E-35	442	0.469	0.993	7mgeB.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
4	PDB:7o2wB	0.358	0.726	3.470E-33	422	0.446	0.991	7o2wB.pdb.gz
5	PDB:6lt0B	0.344	0.792	1.344E-30	386	0.407	0.987	6lt0B.pdb.gz
6	PDB:6v4uB	0.354	0.717	1.808E-26	421	0.442	0.983	6v4uB.pdb.gz
7	PDB:7mgeC	0.160	0.377	1.643E-4	365	0.046	0.118	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
8	PDB:8dhbJ	0.112	0.278	2.113E-3	361	0.032	0.083	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
9	PDB:6lt0C	0.165	0.375	2.215E-3	385	0.052	0.127	6lt0C.pdb.gz
10	PDB:6ulgL	0.169	0.324	3.554E-3	458	0.038	0.079	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
11	PDB:6nzdH	0.164	0.372	1.106E-2	387	0.033	0.080	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
12	PDB:6ulgN	0.081	0.142	1.693E-2	483	0.020	0.039	6ulgN.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
13	AFDB:X1WE18	0.051	0.046	8.983E-2	1085	0.140	0.121	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
14	AFDB:Q94LW1	0.044	0.058	7.912E-1	631	0.073	0.108	Q94LW1.pdb.gz	Q94LW1_MAIZE Two-component response regulator OS=Zea mays OX=4577 GN=ZmRR9 PE=2 SV=1
15	AFDB:Q8WYQ9	0.043	0.043	1.002	949	0.099	0.098	Q8WYQ9.pdb.gz	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
16	AFDB:Q9NQ75	0.061	0.069	1.608	786	0.091	0.108	Q9NQ75.pdb.gz	CASS4_HUMAN Cas scaffolding protein family member 4 OS=Homo sapiens OX=9606 GN=CASS4 PE=1 SV=2
17	AFDB:Q14444	0.032	0.041	2.348	709	0.078	0.103	Q14444.pdb.gz	CAPR1_HUMAN Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2
18	AFDB:Q8CEE6	0.068	0.049	2.462	1383	0.095	0.064	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
19	AFDB:P79149	0.051	0.060	2.581	773	0.084	0.102	P79149.pdb.gz	PININ_CANLF Pinin OS=Canis lupus familiaris OX=9615 GN=PNN PE=2 SV=3
20	AFDB:Q588V7	0.081	0.039	2.581	2154	0.104	0.045	Q588V7.pdb.gz	TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana OX=3702 GN=TEB PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UMB5	0.0	1692	935	0.898	0.899	SMCR8_MOUSE Guanine nucleotide exchange protein SMCR8 OS=Mus musculus OX=10090 GN=Smcr8 PE=1 SV=2
2	Q8TEV9	0.0	1933	937	1.000	1.000	SMCR8_HUMAN Guanine nucleotide exchange protein SMCR8 OS=Homo sapiens OX=9606 GN=SMCR8 PE=1 SV=2
3	O48449	3.4	33.5	264	0.020	0.072	TUBE_BPSPP Tail tube protein gp17.1* OS=Bacillus phage SPP1 OX=10724 GN=17.1 PE=1 SV=2
4	Q92355	3.5	33.9	1687	0.014	0.008	SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sen1 PE=1 SV=1
5	A0A2R8Y4X0	5.5	33.1	829	0.023	0.027	A0A2R8Y4X0_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=KSR1 PE=1 SV=1
6	A0A0A0MQW1	6.5	33.1	846	0.023	0.026	A0A0A0MQW1_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=KSR1 PE=1 SV=1
7	Q8IVT5	6.5	33.1	923	0.023	0.024	KSR1_HUMAN Kinase suppressor of Ras 1 OS=Homo sapiens OX=9606 GN=KSR1 PE=1 SV=3
8	A0A2R8Y5H9	6.7	33.1	928	0.023	0.024	A0A2R8Y5H9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=KSR1 PE=1 SV=1
9	Q9VKD6	9.4	32.0	231	0.048	0.195	DGT2_DROME Augmin complex subunit dgt2 OS=Drosophila melanogaster OX=7227 GN=dgt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11704 Folliculin	0.00053	31.4	Vesicle coat protein involved in Golgi to plasma membrane transport
2	PF18586 zf-CCCH_7	4.1e+02	12.7	Chromatin remodeling factor Mit1 C-terminal Zn finger 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296679	0.999	WD repeat-containing protein 41
2	9606.ENSP00000482753	0.999	Guanine nucleotide exchange C9orf72
3	9606.ENSP00000358466	0.971	Ras-related protein Rab-39B
4	9606.ENSP00000300935	0.939	Ras-related protein Rab-8A
5	9606.ENSP00000329967	0.936	Serine/threonine-protein kinase TBK1
6	9606.ENSP00000025008	0.921	RB1-inducible coiled-coil protein 1
7	9606.ENSP00000324560	0.883	Serine/threonine-protein kinase ULK1
8	9606.ENSP00000376505	0.883	TRAF family member-associated NF-kappa-B activator
9	9606.ENSP00000432412	0.880	Autophagy-related protein 13
10	9606.ENSP00000285071	0.866	Folliculin
11	9606.ENSP00000378914	0.831	Serine/threonine-protein kinase ULK2
12	9606.ENSP00000310933	0.794	MAP kinase-activating death domain protein
13	9606.ENSP00000362092	0.758	Ras-related GTP-binding protein C
14	9606.ENSP00000416696	0.750	RAB6A-GEF complex partner protein 1
15	9606.ENSP00000321584	0.738	Inosine-5'-monophosphate dehydrogenase 2
16	9606.ENSP00000280333	0.729	Dedicator of cytokinesis protein 1
17	9606.ENSP00000367318	0.726	RAB6A-GEF complex partner protein 2
18	9606.ENSP00000282096	0.720	cGMP-inhibited 3',5'-cyclic phosphodiesterase B
19	9606.ENSP00000304437	0.720	Protein very KIND
20	9606.ENSP00000312185	0.720	Engulfment and cell motility protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.996	guanyl-nucleotide exchange factor activity
GO:0004860	0.991	protein kinase inhibitor activity
GO:0019901	0.990	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048519	0.978	negative regulation of biological process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0048583	0.958	regulation of response to stimulus
GO:0051246	0.957	regulation of protein metabolic process
GO:0023051	0.956	regulation of signaling
GO:0051128	0.952	regulation of cellular component organization
GO:1902531	0.951	regulation of intracellular signal transduction
GO:0048523	0.943	negative regulation of cellular process
GO:0048518	0.932	positive regulation of biological process
GO:0009892	0.918	negative regulation of metabolic process
GO:0065009	0.891	regulation of molecular function
GO:0031399	0.891	regulation of protein modification process
GO:0048522	0.879	positive regulation of cellular process
GO:0009893	0.869	positive regulation of metabolic process
GO:0031323	0.849	regulation of cellular metabolic process
GO:0009894	0.826	regulation of catabolic process
GO:0031325	0.804	positive regulation of cellular metabolic process
GO:0050790	0.794	regulation of catalytic activity
GO:0044088	0.762	regulation of vacuole organization
GO:0032006	0.754	regulation of TOR signaling
GO:0051174	0.708	regulation of phosphorus metabolic process
GO:0010506	0.668	regulation of autophagy
GO:0009987	0.663	cellular process
GO:0016241	0.651	regulation of macroautophagy
GO:0009895	0.643	negative regulation of catabolic process
GO:0048584	0.576	positive regulation of response to stimulus
GO:0031324	0.553	negative regulation of cellular metabolic process
GO:0051345	0.521	positive regulation of hydrolase activity
GO:0019220	0.511	regulation of phosphate metabolic process
GO:0009896	0.511	positive regulation of catabolic process
GO:0044087	0.488	regulation of cellular component biogenesis
GO:0031331	0.436	positive regulation of cellular catabolic process
GO:0010508	0.429	positive regulation of autophagy
GO:0043547	0.423	positive regulation of GTPase activity
GO:0010605	0.407	negative regulation of macromolecule metabolic process
GO:0042325	0.382	regulation of phosphorylation
GO:0051172	0.373	negative regulation of nitrogen compound metabolic process
GO:0051248	0.359	negative regulation of protein metabolic process
GO:0010468	0.340	regulation of gene expression
GO:1902115	0.338	regulation of organelle assembly
GO:0031330	0.335	negative regulation of cellular catabolic process
GO:0042326	0.328	negative regulation of phosphorylation
GO:0016239	0.327	positive regulation of macroautophagy
GO:0010507	0.315	negative regulation of autophagy
GO:2000785	0.309	regulation of autophagosome assembly
GO:0051129	0.307	negative regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.991	nucleoplasm
GO:0032991	0.975	protein-containing complex
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:0005829	0.960	cytosol
GO:0016020	0.934	membrane
GO:0031090	0.883	organelle membrane
GO:0140535	0.847	intracellular protein-containing complex
GO:0012505	0.781	endomembrane system
GO:1902494	0.720	catalytic complex
GO:1990234	0.689	transferase complex
GO:0061695	0.637	transferase complex, transferring phosphorus-containing groups
GO:0032045	0.616	guanyl-nucleotide exchange factor complex
GO:1990316	0.613	Atg1/ULK1 kinase complex
GO:0030054	0.591	cell junction
GO:0005694	0.456	chromosome
GO:0045202	0.423	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]