StarFunc result for job id Q8TEW0

User Input

>input (1356 residues)
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDE
DGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAME
TLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGR
ESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGL
GDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDY
AEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSP
VDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVE
VQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPS
YAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IZU1	0.178	0.179	0.000	1347	0.665	0.670	A0A0R4IZU1.pdb.gz
2	AFDB:Q8TEW0	1.000	1.000	0.000	1356	1.000	1.000	Q8TEW0.pdb.gz	PARD3_HUMAN Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2
3	AFDB:Q99NH2	0.140	0.142	0.000	1333	0.897	0.912	Q99NH2.pdb.gz	PARD3_MOUSE Partitioning defective 3 homolog OS=Mus musculus OX=10090 GN=Pard3 PE=1 SV=2
4	AFDB:Q17353	0.091	0.090	8.400E-39	1379	0.190	0.186	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
5	AFDB:Q7KRY7	0.074	0.057	2.261E-22	1851	0.143	0.105	Q7KRY7.pdb.gz	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
6	PDB:2xkxA	0.066	0.120	1.052E-13	721	0.068	0.128	2xkxA.pdb.gz
7	AFDB:Q9JIS1	0.083	0.074	8.284E-12	1555	0.132	0.115	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
8	AFDB:A0A1D5NS76	0.068	0.048	1.160E-11	2005	0.146	0.099	A0A1D5NS76.pdb.gz
9	AFDB:P39447	0.069	0.060	4.979E-11	1745	0.138	0.107	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
10	AFDB:O97758	0.074	0.059	1.149E-9	1769	0.133	0.102	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
11	AFDB:A1Z9K8	0.067	0.051	4.169E-9	1871	0.142	0.103	A1Z9K8.pdb.gz	A1Z9K8_DROME LD13733p OS=Drosophila melanogaster OX=7227 GN=Prosap PE=2 SV=2
12	PDB:7pc3A	0.065	0.210	7.731E-8	405	0.029	0.096	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7p73A	0.064	0.197	1.792E-7	420	0.026	0.083	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:5n7dA	0.064	0.200	1.274E-6	423	0.017	0.054	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
15	PDB:7pcbA	0.061	0.192	1.268E-5	415	0.021	0.070	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7qqmA	0.062	0.197	1.419E-5	413	0.022	0.073	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:6t36A	0.062	0.824	1.775E-5	93	0.015	0.215	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
18	PDB:6pcvA	0.055	0.097	2.940E-5	754	0.029	0.053	6pcvA.pdb.gz
19	PDB:7pc5A	0.065	0.207	1.129E-4	405	0.021	0.072	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7p70A	0.061	0.195	1.194E-4	407	0.020	0.066	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I3RSA7	0.0	2432	1311	0.918	0.950	A0A8I3RSA7_CANLF Par-3 family cell polarity regulator OS=Canis lupus familiaris OX=9615 GN=PARD3 PE=1 SV=1
2	Q5VWV2	0.0	2643	1296	0.956	1.000	Q5VWV2_HUMAN Par-3 family cell polarity regulator OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=1
3	Q7T1R3	0.0	1339	1127	0.568	0.683	Q7T1R3_DANRE ASIP OS=Danio rerio OX=7955 GN=bazooka PE=1 SV=1
4	Q8TEW0	0.0	2803	1356	1.000	1.000	PARD3_HUMAN Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2
5	Q99NH2	0.0	2391	1333	0.897	0.913	PARD3_MOUSE Partitioning defective 3 homolog OS=Mus musculus OX=10090 GN=Pard3 PE=1 SV=2
6	Q9Z340	0.0	2388	1337	0.897	0.909	PARD3_RAT Partitioning defective 3 homolog OS=Rattus norvegicus OX=10116 GN=Pard3 PE=1 SV=1
7	Q8TEW8	1.00e-169	541	1205	0.292	0.329	PAR3L_HUMAN Partitioning defective 3 homolog B OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=2
8	A0A087WZG6	2.57e-156	500	1030	0.230	0.303	A0A087WZG6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
9	A0A087WYL6	1.16e-116	393	1062	0.156	0.200	A0A087WYL6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
10	Q9CSB4	1.04e-115	394	1203	0.160	0.180	PAR3L_MOUSE Partitioning defective 3 homolog B OS=Mus musculus OX=10090 GN=Pard3b PE=1 SV=2
11	X2JFU8	1.98e-78	288	1499	0.191	0.173	X2JFU8_DROME Bazooka, isoform C OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
12	Q9VX75	2.04e-78	288	1464	0.191	0.177	Q9VX75_DROME Bazooka, isoform A OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
13	O96782	3.08e-78	287	1464	0.192	0.178	O96782_DROME Bazooka protein OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
14	X2JCB3	3.42e-64	243	1485	0.176	0.160	X2JCB3_DROME Bazooka, isoform D OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
15	Q0KHR3	3.77e-64	243	1520	0.176	0.157	Q0KHR3_DROME Bazooka, isoform B OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
16	A0A087X1S9	1.39e-63	239	1069	0.167	0.211	A0A087X1S9_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
17	Q17353	1.57e-25	117	1379	0.062	0.061	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
18	O75970	2.86e-22	107	2070	0.083	0.055	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2
19	O55164	3.71e-22	106	2054	0.080	0.053	MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1
20	Q63ZW7	4.15e-21	103	1834	0.055	0.041	INADL_MOUSE InaD-like protein OS=Mus musculus OX=10090 GN=Patj PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12053 Par3_HAL_N_term	4.3e-37	137.5	N-terminal of Par3 and HAL proteins
2	PF00595 PDZ	9.8e-34	126.9	PDZ domain
3	PF13180 PDZ_2	9.8e-11	53.2	PDZ domain
4	PF17820 PDZ_6	1.4e-12	58.6	PDZ domain
5	PF13414 TPR_11	6.4e+02	11.5	TPR repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219255	0.999	Partitioning defective 6 homolog alpha
2	9606.ENSP00000295797	0.999	Protein kinase C iota type
3	9606.ENSP00000383118	0.999	Cell division control protein 42 homolog
4	9606.ENSP00000360672	0.998	Partitioning defective 6 homolog beta
5	9606.ENSP00000343144	0.995	Partitioning defective 6 homolog gamma
6	9606.ENSP00000361021	0.993	Phosphatase and tensin homolog
7	9606.ENSP00000367830	0.990	Protein kinase C zeta type
8	9606.ENSP00000286827	0.987	T-lymphoma invasion and metastasis-inducing protein 1
9	9606.ENSP00000357005	0.979	Junctional adhesion molecule A
10	9606.ENSP00000299106	0.969	Junctional adhesion molecule C
11	9606.ENSP00000368872	0.958	Protein inscuteable homolog
12	9606.ENSP00000261681	0.949	MAGUK p55 subfamily member 5
13	9606.ENSP00000360200	0.918	InaD-like protein
14	9606.ENSP00000341957	0.917	Apoptosis-stimulating of p53 protein 2
15	9606.ENSP00000384491	0.915	Ras association domain family member 8
16	9606.ENSP00000383376	0.914	Junctional adhesion molecule B
17	9606.ENSP00000451300	0.914	Protein numb homolog
18	9606.ENSP00000347379	0.909	Occludin
19	9606.ENSP00000418070	0.897	Nectin-3
20	9606.ENSP00000324806	0.882	Glycogen synthase kinase-3 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071840	0.986	cellular component organization or biogenesis
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.978	response to stimulus
GO:0016043	0.972	cellular component organization
GO:0051179	0.966	localization
GO:0051128	0.957	regulation of cellular component organization
GO:0048856	0.956	anatomical structure development
GO:0032501	0.955	multicellular organismal process
GO:0030029	0.948	actin filament-based process
GO:0060429	0.935	epithelium development
GO:0006996	0.934	organelle organization
GO:0007163	0.920	establishment or maintenance of cell polarity
GO:0007275	0.910	multicellular organism development
GO:0061842	0.907	microtubule organizing center localization
GO:0061245	0.907	establishment or maintenance of bipolar cell polarity
GO:0051641	0.905	cellular localization
GO:0007010	0.905	cytoskeleton organization
GO:0008104	0.892	protein localization
GO:0021782	0.864	glial cell development
GO:0051234	0.852	establishment of localization
GO:0034330	0.845	cell junction organization
GO:0008366	0.840	axon ensheathment
GO:0051716	0.814	cellular response to stimulus
GO:0051649	0.778	establishment of localization in cell
GO:0035088	0.766	establishment or maintenance of apical/basal cell polarity
GO:0048518	0.756	positive regulation of biological process
GO:0048729	0.756	tissue morphogenesis
GO:0023052	0.722	signaling
GO:0042552	0.722	myelination
GO:0007154	0.718	cell communication
GO:0007165	0.702	signal transduction
GO:0032879	0.694	regulation of localization
GO:0065008	0.686	regulation of biological quality
GO:0032292	0.655	peripheral nervous system axon ensheathment
GO:0048522	0.651	positive regulation of cellular process
GO:0014044	0.615	Schwann cell development
GO:0022011	0.613	myelination in peripheral nervous system
GO:0002009	0.600	morphogenesis of an epithelium
GO:0016477	0.541	cell migration
GO:0050793	0.538	regulation of developmental process
GO:0048699	0.529	generation of neurons
GO:0051642	0.510	centrosome localization
GO:0022607	0.495	cellular component assembly
GO:0019222	0.470	regulation of metabolic process
GO:0048519	0.461	negative regulation of biological process
GO:0030182	0.461	neuron differentiation
GO:0031323	0.406	regulation of cellular metabolic process
GO:0060255	0.393	regulation of macromolecule metabolic process
GO:0048523	0.393	negative regulation of cellular process
GO:0045197	0.378	establishment or maintenance of epithelial cell apical/basal polarity
GO:0080090	0.373	regulation of primary metabolic process
GO:0051171	0.372	regulation of nitrogen compound metabolic process
GO:0034329	0.336	cell junction assembly
GO:0010646	0.303	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.997	intracellular anatomical structure
GO:0005886	0.997	plasma membrane
GO:0005911	0.996	cell-cell junction
GO:0005737	0.994	cytoplasm
GO:0005829	0.946	cytosol
GO:0043226	0.806	organelle
GO:0032991	0.766	protein-containing complex
GO:0043229	0.724	intracellular organelle
GO:0043227	0.625	membrane-bounded organelle
GO:0043231	0.615	intracellular membrane-bounded organelle
GO:0120157	0.367	PAR polarity complex
GO:0070160	0.337	tight junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]