StarFunc result for job id Q8TEW6

User Input

>input (326 residues)
MATNFSDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVT
EISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDIS
LGEPDLLAPGVQCEQTDRFNVFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWP
LCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLE
MEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSET
DLLNRFILLKPKPSQGDSSEAKTPSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4IFJ7	0.751	0.751	3.601E-54	326	0.985	0.985	A4IFJ7.pdb.gz	A4IFJ7_BOVIN DOK4 protein OS=Bos taurus OX=9913 GN=DOK4 PE=2 SV=1
2	AFDB:Q2MHE5	0.823	0.811	1.630E-43	331	0.632	0.622	Q2MHE5.pdb.gz	DOK6_MOUSE Docking protein 6 OS=Mus musculus OX=10090 GN=Dok6 PE=1 SV=1
3	AFDB:Q91ZM9	0.824	0.875	6.744E-41	306	0.543	0.578	Q91ZM9.pdb.gz	DOK5_MOUSE Docking protein 5 OS=Mus musculus OX=10090 GN=Dok5 PE=1 SV=1
4	AFDB:Q9W3R6	0.310	0.172	3.218E-18	622	0.212	0.111	Q9W3R6.pdb.gz	Q9W3R6_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=Dok PE=2 SV=1
5	AFDB:P97465	0.319	0.227	1.121E-17	482	0.242	0.164	P97465.pdb.gz	DOK1_MOUSE Docking protein 1 OS=Mus musculus OX=10090 GN=Dok1 PE=1 SV=2
6	AFDB:O70469	0.291	0.242	1.828E-17	412	0.242	0.192	O70469.pdb.gz	DOK2_MOUSE Docking protein 2 OS=Mus musculus OX=10090 GN=Dok2 PE=1 SV=1
7	AFDB:B0S6R3	0.284	0.182	2.398E-17	530	0.236	0.145	B0S6R3.pdb.gz
8	AFDB:Q99704	0.291	0.203	5.412E-17	481	0.227	0.154	Q99704.pdb.gz	DOK1_HUMAN Docking protein 1 OS=Homo sapiens OX=9606 GN=DOK1 PE=1 SV=1
9	AFDB:O60496	0.290	0.235	1.518E-16	412	0.242	0.192	O60496.pdb.gz	DOK2_HUMAN Docking protein 2 OS=Homo sapiens OX=9606 GN=DOK2 PE=1 SV=2
10	AFDB:Q9QZK7	0.286	0.215	4.496E-16	444	0.218	0.160	Q9QZK7.pdb.gz	DOK3_MOUSE Docking protein 3 OS=Mus musculus OX=10090 GN=Dok3 PE=1 SV=1
11	PDB:3ljuX	0.247	0.219	1.162E-5	373	0.086	0.075	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	PDB:7c3mA	0.210	0.124	2.770E-5	577	0.113	0.064	7c3mA.pdb.gz
13	PDB:6r9tA	0.232	0.039	5.609E-5	2185	0.095	0.014	6r9tA.pdb.gz
14	PDB:6hhgA	0.247	0.211	6.601E-5	386	0.071	0.060	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
15	PDB:6s9wA	0.248	0.199	3.364E-4	411	0.086	0.068	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
16	PDB:6xtbE	0.223	0.302	3.750E-4	235	0.095	0.132	6xtbE.pdb.gz
17	PDB:6u3eA	0.232	0.193	4.659E-4	397	0.046	0.038	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:4mk0A	0.258	0.139	6.112E-4	631	0.071	0.036	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:4rm8A	0.233	0.208	1.172E-3	368	0.055	0.049	4rm8A.pdb.gz
20	PDB:6bbpA	0.245	0.158	1.457E-3	520	0.061	0.038	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4IFJ7	0.0	677	326	0.985	0.985	A4IFJ7_BOVIN DOK4 protein OS=Bos taurus OX=9913 GN=DOK4 PE=2 SV=1
2	Q8TEW6	0.0	684	326	1.000	1.000	DOK4_HUMAN Docking protein 4 OS=Homo sapiens OX=9606 GN=DOK4 PE=1 SV=2
3	Q99KE3	0.0	668	325	0.982	0.985	DOK4_MOUSE Docking protein 4 OS=Mus musculus OX=10090 GN=Dok4 PE=1 SV=1
4	Q6PKX4	3.04e-156	442	331	0.620	0.610	DOK6_HUMAN Docking protein 6 OS=Homo sapiens OX=9606 GN=DOK6 PE=1 SV=1
5	Q2MHE5	4.61e-156	441	331	0.620	0.610	DOK6_MOUSE Docking protein 6 OS=Mus musculus OX=10090 GN=Dok6 PE=1 SV=1
6	Q9P104	2.40e-133	383	306	0.552	0.588	DOK5_HUMAN Docking protein 5 OS=Homo sapiens OX=9606 GN=DOK5 PE=1 SV=2
7	Q91ZM9	2.62e-133	383	306	0.549	0.585	DOK5_MOUSE Docking protein 5 OS=Mus musculus OX=10090 GN=Dok5 PE=1 SV=1
8	Q99704	4.71e-13	71.6	481	0.221	0.150	DOK1_HUMAN Docking protein 1 OS=Homo sapiens OX=9606 GN=DOK1 PE=1 SV=1
9	P97465	1.82e-11	67.0	482	0.199	0.135	DOK1_MOUSE Docking protein 1 OS=Mus musculus OX=10090 GN=Dok1 PE=1 SV=2
10	O60496	5.36e-11	65.5	412	0.092	0.073	DOK2_HUMAN Docking protein 2 OS=Homo sapiens OX=9606 GN=DOK2 PE=1 SV=2
11	O70469	7.94e-11	64.7	412	0.089	0.070	DOK2_MOUSE Docking protein 2 OS=Mus musculus OX=10090 GN=Dok2 PE=1 SV=1
12	Q9QZK7	8.96e-09	58.5	444	0.098	0.072	DOK3_MOUSE Docking protein 3 OS=Mus musculus OX=10090 GN=Dok3 PE=1 SV=1
13	E7F4P8	1.78e-08	58.2	1099	0.193	0.057	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
14	O43559	9.08e-08	55.8	492	0.077	0.051	FRS3_HUMAN Fibroblast growth factor receptor substrate 3 OS=Homo sapiens OX=9606 GN=FRS3 PE=1 SV=3
15	Q52RG8	2.96e-07	53.9	492	0.074	0.049	FRS3_RAT Fibroblast growth factor receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Frs3 PE=2 SV=3
16	Q7L591	1.14e-06	52.4	496	0.083	0.054	DOK3_HUMAN Docking protein 3 OS=Homo sapiens OX=9606 GN=DOK3 PE=1 SV=2
17	Q9DF49	1.68e-06	52.0	1074	0.190	0.058	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
18	D4A244	1.02e-05	49.3	508	0.055	0.035	D4A244_RAT Fibroblast growth factor receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Frs2 PE=1 SV=1
19	A0A384NQ31	1.05e-05	49.3	512	0.055	0.035	A0A384NQ31_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
20	Q8C180	1.08e-05	49.3	508	0.055	0.035	FRS2_MOUSE Fibroblast growth factor receptor substrate 2 OS=Mus musculus OX=10090 GN=Frs2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02174 IRS	1.8e-25	100.0	PTB domain (IRS-1 type)
2	PF00169 PH	0.068	25.1	PH domain
3	PF15413 PH_11	16	17.4	Pleckstrin homology domain
4	PF06534 RGM_C	61	14.5	Repulsive guidance molecule (RGM) C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010363786.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351276.1	0.774	Proto-oncogene tyrosine-protein kinase receptor Ret
2	61622.XP_010371797.1	0.727	CRK proto-oncogene, adaptor protein
3	61622.XP_010351861.1	0.714	Belongs to the semaphorin family.
4	61622.XP_010378604.1	0.714	Protein EFR3 homolog A isoform X1
5	61622.XP_010357377.1	0.709	RAP1A, member of RAS oncogene family
6	61622.XP_010368587.1	0.707	Collagen alpha-2(V) chain isoform X1
7	61622.XP_010354074.1	0.674	Zinc finger protein 436
8	61622.XP_010384188.1	0.674	Tyrosine-protein phosphatase non-receptor type 6
9	61622.XP_010365968.1	0.664	Glial cell derived neurotrophic factor
10	61622.XP_010360138.1	0.663	Sprouty RTK signaling antagonist 2
11	61622.XP_010353661.1	0.658	Proto-oncogene tyrosine-protein kinase Src
12	61622.XP_010387534.1	0.648	Transmembrane protein 184B
13	61622.XP_010373192.1	0.640	ADAMTS-like protein 5
14	61622.XP_010387209.1	0.636	GDNF family receptor alpha-1 isoform X1
15	61622.XP_010358308.1	0.634	Prolyl 4-hydroxylase subunit alpha 2
16	61622.XP_010383058.1	0.597	Insulin receptor substrate 2
17	61622.XP_010371376.1	0.595	Prolyl 4-hydroxylase subunit alpha 1
18	61622.XP_010367285.1	0.586	Crk-like protein
19	61622.XP_010382706.1	0.580	Protein Dok-7 isoform X1
20	61622.XP_010351664.1	0.568	Plakophilin 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.502	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009966	0.993	regulation of signal transduction
GO:0007165	0.990	signal transduction
GO:0048518	0.982	positive regulation of biological process
GO:0032501	0.978	multicellular organismal process
GO:0032502	0.977	developmental process
GO:0048522	0.973	positive regulation of cellular process
GO:0048856	0.967	anatomical structure development
GO:0007169	0.950	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0043408	0.932	regulation of MAPK cascade
GO:1902533	0.927	positive regulation of intracellular signal transduction
GO:0007275	0.926	multicellular organism development
GO:0043410	0.915	positive regulation of MAPK cascade
GO:0048731	0.897	system development
GO:0007399	0.872	nervous system development
GO:0030154	0.355	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043226	0.919	organelle
GO:0043231	0.810	intracellular membrane-bounded organelle
GO:0071944	0.433	cell periphery
GO:0005886	0.423	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]