StarFunc result for job id Q8TEW8

User Input

>input (1205 residues)
MKVTVCFGRTGIVVPCKEGQLRVGELTQQALQRYLKTREKGPGYWVKIHHLEYTDGGILD
PDDVLADVVEDKDKLIAVFEEQEPLHKIESPSGNPADRQSPDAFETEVAAQLAAFKPIGG
EIEVTPSALKLGTPLLVRRSSDPVPGPPADTQPSASHPGGQSLKLVVPDSTQNLEDREVL
NGVQTELLTSPRTKDTLSDMTRTVEISGEGGPLGIHVVPFFSSLSGRILGLFIRGIEDNS
RSKREGLFHENECIVKINNVDLVDKTFAQAQDVFRQAMKSPSVLLHVLPPQNREQYEKSV
IGSLNIFGNNDGVLKTKVPPPVHGKSGLKTANLTGTDSPETDASASLQQNKSPRVPRLGG
KPSSPSLSPLMGFGSNKNAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGA
AIKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGETASLVIARQEGHFLPRELKG
EPDCCALSLETSEQLTFEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFK
DGRLRMNDQLIAVNGESLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPMEDPA
ECGAFSKPCFENCQNAVTTSRRNDNSILHPLGTCSPQDKQKGLLLPNDGWAESEVPPSPT
PHSALGLGLEDYSHSSGVDSAVYFPDQHINFRSVTPARQPESINLKASKSMDLVPDESKV
HSLAGQKSESPSKDFGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPRPHMVRGRGCNES
FRAAIDKSYDGPEEIEADGLSDKSSHSGQGALNCESAPQGNSELEDMENKARKVKKTKEK
EKKKEKGKLKVKEKKRKEENEDPERKIKKKGFGAMLRFGKKKEDKGGKAEQKGTLKHGGL
REEELEKMKEERERIGAKHQELREKQARGLLDYATGAIGSVYDMDDDEMDPNYARVNHFR
EPCTSANVFRSPSPPRAGPFGYPRDGHPLSPERDHLEGLYAKVNKPYHPLVPADSGRPTG
GSTDRIQKLRKEYYQARREGFPLYEDDEGRARPSEYDLLWVPGRGPDGNAHNLRFEGMER
QYASLPRGGPADPVDYLPAAPRGLYKERELPYYPGAHPMHPPKGSYPRPTELRVADLRYP
QHYPPPPAPQHKGPFRQDVPPSPPQHQRMPAYQETGRPGPRGGSPDQYPYRTQDSRQKNP
MTAAV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEW8	0.999	0.999	0.000	1205	1.000	1.000	Q8TEW8.pdb.gz	PAR3L_HUMAN Partitioning defective 3 homolog B OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=2
2	AFDB:Q9CSB4	0.426	0.427	0.000	1203	0.842	0.844	Q9CSB4.pdb.gz	PAR3L_MOUSE Partitioning defective 3 homolog B OS=Mus musculus OX=10090 GN=Pard3b PE=1 SV=2
3	AFDB:Q17353	0.180	0.162	9.176E-36	1379	0.227	0.199	Q17353.pdb.gz	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
4	PDB:2xkxA	0.076	0.118	2.793E-15	721	0.079	0.132	2xkxA.pdb.gz
5	AFDB:Q99NE5	0.077	0.065	1.037E-11	1463	0.136	0.112	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
6	AFDB:Q9JIR4	0.076	0.060	1.450E-11	1615	0.145	0.108	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
7	AFDB:P39447	0.074	0.058	4.162E-10	1745	0.174	0.120	P39447.pdb.gz	ZO1_MOUSE Tight junction protein ZO-1 OS=Mus musculus OX=10090 GN=Tjp1 PE=1 SV=2
8	AFDB:Q9JIS1	0.074	0.059	5.822E-10	1555	0.134	0.104	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1
9	AFDB:O97758	0.074	0.057	9.108E-10	1769	0.165	0.112	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
10	AFDB:E9Q9R9	0.088	0.059	1.019E-9	1921	0.104	0.065	E9Q9R9.pdb.gz	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
11	AFDB:Q9VUQ9	0.078	0.048	2.209E-8	2139	0.138	0.078	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
12	PDB:7p73A	0.070	0.194	8.986E-8	420	0.028	0.081	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
13	PDB:7pc3A	0.074	0.211	1.005E-7	405	0.030	0.089	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:5n7dA	0.073	0.204	5.090E-7	423	0.025	0.071	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
15	PDB:7qqmA	0.071	0.201	5.045E-6	413	0.026	0.075	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:6t36A	0.071	0.819	7.893E-6	93	0.018	0.237	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
17	PDB:7pcbA	0.068	0.192	9.873E-6	415	0.022	0.065	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:6pcvA	0.063	0.099	5.593E-5	754	0.030	0.048	6pcvA.pdb.gz
19	PDB:7p70A	0.067	0.191	9.253E-5	407	0.020	0.059	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7pc5A	0.074	0.211	1.619E-4	405	0.026	0.077	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WYL6	0.0	1320	1062	0.543	0.616	A0A087WYL6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
2	A0A087WZG6	0.0	1573	1030	0.685	0.802	A0A087WZG6_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
3	A0A087X1S9	0.0	2119	1069	0.877	0.989	A0A087X1S9_HUMAN Par-3 family cell polarity regulator beta (Fragment) OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=1
4	Q5VWV2	0.0	694	1296	0.435	0.404	Q5VWV2_HUMAN Par-3 family cell polarity regulator OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=1
5	Q8TEW8	0.0	2463	1205	1.000	1.000	PAR3L_HUMAN Partitioning defective 3 homolog B OS=Homo sapiens OX=9606 GN=PARD3B PE=1 SV=2
6	Q9CSB4	0.0	1924	1203	0.842	0.844	PAR3L_MOUSE Partitioning defective 3 homolog B OS=Mus musculus OX=10090 GN=Pard3b PE=1 SV=2
7	Q99NH2	7.69e-179	564	1333	0.360	0.326	PARD3_MOUSE Partitioning defective 3 homolog OS=Mus musculus OX=10090 GN=Pard3 PE=1 SV=2
8	Q8TEW0	2.84e-174	553	1356	0.361	0.321	PARD3_HUMAN Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3 PE=1 SV=2
9	Q9Z340	4.37e-174	552	1337	0.356	0.321	PARD3_RAT Partitioning defective 3 homolog OS=Rattus norvegicus OX=10116 GN=Pard3 PE=1 SV=1
10	A0A8I3RSA7	1.25e-166	531	1311	0.253	0.233	A0A8I3RSA7_CANLF Par-3 family cell polarity regulator OS=Canis lupus familiaris OX=9615 GN=PARD3 PE=1 SV=1
11	Q7T1R3	7.49e-114	384	1127	0.178	0.190	Q7T1R3_DANRE ASIP OS=Danio rerio OX=7955 GN=bazooka PE=1 SV=1
12	X2JCB3	3.17e-29	129	1485	0.072	0.059	X2JCB3_DROME Bazooka, isoform D OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
13	Q0KHR3	3.68e-29	129	1520	0.072	0.057	Q0KHR3_DROME Bazooka, isoform B OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
14	Q9VX75	3.76e-29	129	1464	0.072	0.059	Q9VX75_DROME Bazooka, isoform A OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
15	X2JFU8	3.98e-29	129	1499	0.072	0.058	X2JFU8_DROME Bazooka, isoform C OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
16	O96782	1.24e-28	127	1464	0.071	0.059	O96782_DROME Bazooka protein OS=Drosophila melanogaster OX=7227 GN=baz PE=1 SV=1
17	Q17353	1.70e-23	110	1379	0.066	0.057	PAR3_CAEEL Partitioning defective protein 3 OS=Caenorhabditis elegans OX=6239 GN=par-3 PE=1 SV=1
18	Q8NI35	5.81e-21	102	1801	0.059	0.039	INADL_HUMAN InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3
19	E2QYC9	6.09e-21	102	1828	0.090	0.060	INADL_CANLF InaD-like protein OS=Canis lupus familiaris OX=9615 GN=PATJ PE=1 SV=3
20	A0A2R8Y549	7.04e-21	102	1882	0.059	0.038	A0A2R8Y549_HUMAN PATJ crumbs cell polarity complex component OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12053 Par3_HAL_N_term	6.6e-38	140.2	N-terminal of Par3 and HAL proteins
2	PF00595 PDZ	4.8e-31	118.3	PDZ domain
3	PF13180 PDZ_2	8.8e-09	46.9	PDZ domain
4	PF17820 PDZ_6	2.2e-14	64.4	PDZ domain
5	PF02163 Peptidase_M50	0.74	20.6	Peptidase family M50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003820829.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003831969.1	0.947	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
2	9597.XP_003815309.1	0.852	Par-6 family cell polarity regulator beta
3	9597.XP_008962834.1	0.852	Par-6 family cell polarity regulator alpha
4	9597.XP_008967022.1	0.852	Par-6 family cell polarity regulator gamma
5	9597.XP_003818246.1	0.846	Protein inscuteable homolog isoform X1
6	9597.XP_003807363.1	0.773	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
7	9597.XP_008955419.1	0.759	FERM domain containing 4A
8	9597.XP_008963144.1	0.713	NUMB like, endocytic adaptor protein
9	9597.XP_008976112.1	0.713	NUMB, endocytic adaptor protein
10	9597.XP_003811904.1	0.682	F11 receptor
11	9597.XP_008958707.1	0.672	G-protein-signaling modulator 2
12	9597.XP_003810548.1	0.670	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
13	9597.XP_008950745.1	0.653	Mitochondrial ribosomal protein L33
14	9597.XP_008966732.1	0.653	Zinc finger protein 385B isoform X1
15	9597.XP_003806567.1	0.647	dephospho-CoA kinase domain containing
16	9597.XP_008966570.1	0.639	Calcium/calmodulin dependent serine protein kinase
17	9597.XP_008949747.1	0.631	Catenin beta 1
18	9597.XP_003821483.1	0.627	Membrane palmitoylated protein 7
19	9597.XP_003824112.1	0.627	Belongs to the MAGUK family.
20	9597.XP_003821656.1	0.593	Apolipoprotein B mRNA editing enzyme catalytic subunit 3H

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.997	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0016043	0.948	cellular component organization
GO:0050896	0.945	response to stimulus
GO:0051716	0.822	cellular response to stimulus
GO:0051179	0.741	localization
GO:0048518	0.659	positive regulation of biological process
GO:0023052	0.638	signaling
GO:0007154	0.638	cell communication
GO:0032501	0.596	multicellular organismal process
GO:0007163	0.523	establishment or maintenance of cell polarity
GO:0032502	0.518	developmental process
GO:0048856	0.505	anatomical structure development
GO:0007399	0.472	nervous system development
GO:0019222	0.468	regulation of metabolic process
GO:0048522	0.430	positive regulation of cellular process
GO:0048519	0.413	negative regulation of biological process
GO:0060255	0.409	regulation of macromolecule metabolic process
GO:0030154	0.405	cell differentiation
GO:0051641	0.365	cellular localization
GO:0022008	0.361	neurogenesis
GO:0048523	0.355	negative regulation of cellular process
GO:0080090	0.348	regulation of primary metabolic process
GO:0051171	0.348	regulation of nitrogen compound metabolic process
GO:0007165	0.332	signal transduction
GO:0065008	0.320	regulation of biological quality
GO:0048468	0.317	cell development
GO:0008104	0.316	protein localization
GO:0023051	0.312	regulation of signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	1.000	cell junction
GO:0032991	0.989	protein-containing complex
GO:0016020	0.870	membrane
GO:0005737	0.831	cytoplasm
GO:0043226	0.777	organelle
GO:0043227	0.601	membrane-bounded organelle
GO:0043231	0.550	intracellular membrane-bounded organelle
GO:0071944	0.502	cell periphery
GO:0070161	0.419	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]