StarFunc result for job id Q8TEX9

User Input

>input (1081 residues)
MESAGLEQLLRELLLPDTERIRRATEQLQIVLRAPAALPALCDLLASAADPQIRQFAAVL
TRRRLNTRWRRLAAEQRESLKSLILTALQRETEHCVSLSLAQLSATIFRKEGLEAWPQLL
QLLQHSTHSPHSPEREMGLLLLSVVVTSRPEAFQPHHRELLRLLNETLGEVGSPGLLFYS
LRTLTTMAPYLSTEDVPLARMLVPKLIMAMQTLIPIDEAKACEALEALDELLESEVPVIT
PYLSEVLTFCLEVARNVALGNAIRIRILCCLTFLVKVKSKALLKNRLLPPLLHTLFPIVA
AEPPPGQLDPEDQDSEEEELEIELMGETPKHFAVQVVDMLALHLPPEKLCPQLMPMLEEA
LRSESPYQRKAGLLVLAVLSDGAGDHIRQRLLPPLLQIVCKGLEDPSQVVRNAALFALGQ
FSENLQPHISSYSREVMPLLLAYLKSVPLGHTHHLAKACYALENFVENLGPKVQPYLPEL
MECMLQLLRNPSSPRAKELAVSALGAIATAAQASLLPYFPAIMEHLREFLLTGREDLQPV
QIQSLETLGVLARAVGEPMRPLAEECCQLGLGLCDQVDDPDLRRCTYSLFAALSGLMGEG
LAPHLEQITTLMLLSLRSTEGIVPQYDGSSSFLLFDDESDGEEEEELMDEDVEEEDDSEI
SGYSVENAFFDEKEDTCAAVGEISVNTSVAFLPYMESVFEEVFKLLECPHLNVRKAAHEA
LGQFCCALHKACQSCPSEPNTAALQAALARVVPSYMQAVNRERERQVVMAVLEALTGVLR
SCGTLTLKPPGRLAELCGVLKAVLQRKTACQDTDEEEEEEDDDQAEYDAMLLEHAGEAIP
ALAAAAGGDSFAPFFAGFLPLLVCKTKQGCTVAEKSFAVGTLAETIQGLGAASAQFVSRL
LPVLLSTAQEADPEVRSNAIFGMGVLAEHGGHPAQEHFPKLLGLLFPLLARERHDRVRDN
ICGALARLLMASPTRKPEPQVLAALLHALPLKEDLEEWVTIGRLFSFLYQSSPDQVIDVA
PELLRICSLILADNKIPPDTKAALLLLLTFLAKQHTDSFQAALGSLPVDKAQELQAVLGL
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEX9	1.000	1.000	0.000	1081	1.000	1.000	Q8TEX9.pdb.gz	IPO4_HUMAN Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2
2	AFDB:Q8VI75	0.987	0.987	5.677E-102	1082	0.816	0.815	Q8VI75.pdb.gz	IPO4_MOUSE Importin-4 OS=Mus musculus OX=10090 GN=Ipo4 PE=1 SV=1
3	PDB:7unkA	0.903	0.931	9.956E-93	1047	0.965	0.996	7unkA.pdb.gz
4	PDB:8dyoA	0.559	0.583	2.603E-70	1016	0.934	0.994	8dyoA.pdb.gz	Structure of IMPORTIN-4 bound to the H3-H4-ASF1 histone-histone chaperone complex.
5	AFDB:O60100	0.793	0.802	2.178E-40	1067	0.248	0.251	O60100.pdb.gz	IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap123 PE=3 SV=1
6	AFDB:Q5BBG0	0.821	0.812	1.113E-39	1093	0.251	0.248	Q5BBG0.pdb.gz	Q5BBG0_EMENI Importin subunit beta-4, putative (JCVI) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02120 PE=4 SV=1
7	AFDB:Q93VS8	0.662	0.646	1.985E-35	1116	0.222	0.215	Q93VS8.pdb.gz	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
8	AFDB:P40069	0.803	0.782	5.433E-35	1113	0.228	0.222	P40069.pdb.gz	IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP123 PE=1 SV=1
9	AFDB:O00410	0.694	0.686	1.088E-31	1097	0.203	0.200	O00410.pdb.gz	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
10	AFDB:O60518	0.679	0.667	9.041E-31	1105	0.208	0.204	O60518.pdb.gz	RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2
11	AFDB:Q9VN44	0.708	0.695	4.311E-30	1105	0.200	0.195	Q9VN44.pdb.gz	Q9VN44_DROME FI07923p OS=Drosophila melanogaster OX=7227 GN=Karybeta3 PE=1 SV=1
12	PDB:6xu2A	0.666	0.661	5.160E-30	1091	0.203	0.201	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	AFDB:O74476	0.715	0.707	8.937E-30	1095	0.216	0.214	O74476.pdb.gz	IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sal3 PE=3 SV=1
14	PDB:3w3uA	0.561	0.584	7.737E-26	1030	0.181	0.190	3w3uA.pdb.gz
15	PDB:3w3zA	0.439	0.465	8.010E-26	1013	0.192	0.205	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
16	PDB:4jlqA	0.406	0.502	8.200E-16	840	0.132	0.170	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
17	PDB:1qgkA	0.517	0.623	8.013E-14	876	0.130	0.160	1qgkA.pdb.gz
18	PDB:6n1zA	0.317	0.349	1.160E-12	961	0.159	0.179	6n1zA.pdb.gz
19	PDB:4a0cA	0.323	0.307	1.953E-12	1155	0.146	0.137	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
20	PDB:3nd2A	0.483	0.587	2.963E-12	861	0.130	0.163	3nd2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TEX9	0.0	2160	1081	1.000	1.000	IPO4_HUMAN Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2
2	Q8VI75	0.0	1602	1082	0.810	0.810	IPO4_MOUSE Importin-4 OS=Mus musculus OX=10090 GN=Ipo4 PE=1 SV=1
3	O60100	1.63e-84	298	1067	0.271	0.275	IMB4_SCHPO Probable importin subunit beta-4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=kap123 PE=3 SV=1
4	Q5BBG0	1.00e-80	288	1093	0.263	0.260	Q5BBG0_EMENI Importin subunit beta-4, putative (JCVI) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02120 PE=4 SV=1
5	P40069	4.82e-63	236	1113	0.231	0.225	IMB4_YEAST Importin subunit beta-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP123 PE=1 SV=1
6	Q93VS8	2.07e-44	177	1116	0.230	0.223	Q93VS8_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=KETCH1 PE=1 SV=1
7	O74476	6.60e-41	166	1095	0.259	0.256	IMB3_SCHPO Importin subunit beta-3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sal3 PE=3 SV=1
8	O00410	6.09e-37	153	1097	0.222	0.219	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
9	Q8BKC5	2.46e-36	151	1097	0.221	0.218	IPO5_MOUSE Importin-5 OS=Mus musculus OX=10090 GN=Ipo5 PE=1 SV=3
10	Q8BIV3	3.94e-33	141	1105	0.235	0.230	RNBP6_MOUSE Ran-binding protein 6 OS=Mus musculus OX=10090 GN=Ranbp6 PE=1 SV=3
11	O60518	2.27e-30	132	1105	0.228	0.224	RNBP6_HUMAN Ran-binding protein 6 OS=Homo sapiens OX=9606 GN=RANBP6 PE=1 SV=2
12	Q9VN44	1.62e-26	120	1105	0.232	0.227	Q9VN44_DROME FI07923p OS=Drosophila melanogaster OX=7227 GN=Karybeta3 PE=1 SV=1
13	Q381F2	1.47e-23	110	1149	0.124	0.117	Q381F2_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8030 PE=4 SV=1
14	Q5B163	2.10e-21	103	1095	0.222	0.219	Q5B163_EMENI Importin beta-3 subunit, putative (AFU_orthologue AFUA_1G06790) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05717 PE=3 SV=1
15	Q960E2	3.66e-16	85.9	712	0.151	0.229	Q960E2_DROME SD05186p OS=Drosophila melanogaster OX=7227 GN=Karybeta3 PE=2 SV=1
16	Q28CS8	5.95e-14	78.6	574	0.108	0.204	Q28CS8_XENTR RAN binding protein 5 (Fragment) OS=Xenopus tropicalis OX=8364 GN=ranbp5 PE=2 SV=1
17	C8VUP5	6.08e-10	65.9	939	0.109	0.126	C8VUP5_EMENI KapC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00926 PE=4 SV=1
18	P32337	6.64e-10	65.9	1089	0.143	0.142	IMB3_YEAST Importin subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSE1 PE=1 SV=2
19	Q8I3M5	9.34e-08	58.9	1123	0.054	0.052	Q8I3M5_PLAF7 Karyopherin beta OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0524000 PE=4 SV=1
20	Q8H0U4	8.93e-07	55.8	891	0.134	0.163	TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana OX=3702 GN=TRN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	0.5	20.5	Adaptin N terminal region
2	PF12348 CLASP_N	73	14.4	CLASP N terminal
3	PF12717 Cnd1	0.012	27.1	non-SMC mitotic condensation complex subunit 1
4	PF12765 Cohesin_HEAT	2.8e+02	13.2	HEAT repeat associated with sister chromatid cohesion
5	PF07539 DRIM	2	18.3	Down-regulated in metastasis
6	PF11865 DUF3385	0.0034	28.8	Domain of unknown function (DUF3385)
7	PF11919 DUF3437	5.3e+02	11.9	Domain of unknown function (DUF3437)
8	PF20416 DUF6700	1.3e+02	13.4	Domain of unknown function (DUF6700)
9	PF02985 HEAT	1.1e-14	64.3	HEAT repeat
10	PF13646 HEAT_2	8.2e-19	79.1	HEAT repeats
11	PF13513 HEAT_EZ	7.8e-15	66.4	HEAT-like repeat
12	PF03810 IBN_N	2.8e-07	41.7	Importin-beta N-terminal domain
13	PF05004 IFRD	0.00022	32.0	Interferon-related developmental regulator (IFRD)
14	PF18829 Importin_rep_6	2.3e+02	13.5	Importin repeat 6
15	PF20168 PDS5	0.095	22.1	Sister chromatid cohesion protein PDS5 protein
16	PF08167 RIX1	0.00013	33.3	rRNA processing/ribosome biogenesis
17	PF10363 RTP1_C1	9.6	17.8	Required for nuclear transport of RNA pol II C-terminus 1
18	PF08064 UME	0.00013	33.1	UME (NUC010) domain
19	PF12755 Vac14_Fab1_bd	0.00027	32.8	Vacuolar 14 Fab1-binding region
20	PF08389 Xpo1	2.4e+02	13.2	Exportin 1-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352252	0.974	Histone cluster 1 H3 family member j
2	9606.ENSP00000366999	0.974	Histone cluster 1 H3 family member d
3	9606.ENSP00000480826	0.971	Histone cluster 1 H3 family member a
4	9606.ENSP00000290158	0.970	Importin subunit beta-1
5	9606.ENSP00000446215	0.965	GTP-binding nuclear protein Ran
6	9606.ENSP00000263382	0.964	Histone chaperone ASF1B
7	9606.ENSP00000229595	0.957	Histone chaperone ASF1A
8	9606.ENSP00000262982	0.955	Exportin-2
9	9606.ENSP00000384863	0.955	Exportin-1
10	9606.ENSP00000484658	0.944	Histone cluster 1 H3 family member c
11	9606.ENSP00000476960	0.934	Histone cluster 2 H3 pseudogene 2
12	9606.ENSP00000482271	0.926	Histone cluster 1 H3 family member e
13	9606.ENSP00000446184	0.925	RRP12-like protein
14	9606.ENSP00000484841	0.921	Histone H3.1
15	9606.ENSP00000444136	0.907	DNA-directed RNA polymerase I subunit RPA2
16	9606.ENSP00000386992	0.906	Importin-11
17	9606.ENSP00000354742	0.905	Importin-9
18	9606.ENSP00000455106	0.902	Ribosome biogenesis protein BOP1
19	9606.ENSP00000254810	0.900	H3 histone, family 3B (H3.3B)
20	9606.ENSP00000333277	0.899	Histone cluster 2 H3 family member d

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061608	0.988	nuclear import signal receptor activity
GO:0008139	0.986	nuclear localization sequence binding
GO:0003676	0.410	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0006606	0.968	protein import into nucleus
GO:0065007	0.559	biological regulation
GO:0050789	0.468	regulation of biological process
GO:0050794	0.350	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0032991	0.999	protein-containing complex
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005694	0.987	chromosome
GO:0070013	0.946	intracellular organelle lumen
GO:0043227	0.927	membrane-bounded organelle
GO:0031981	0.899	nuclear lumen
GO:0005737	0.888	cytoplasm
GO:0005829	0.882	cytosol
GO:0000785	0.845	chromatin
GO:0005654	0.585	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]