StarFunc result for job id Q8TEY5

User Input

>input (395 residues)
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGL
QESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSPMLYEVVYEAG
ALERMQGETGPNVGLISIQLDQWSPAFMVPDSCMVSELPFDAHAHILPRAGTVAPVPCTT
LLPCQTLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSNKAAQTSTCVLI
LLFSLALIILPSFSPFQSRPEAGSEDYQPHGVTSRNILTHKDVTENLETQVVESRLREPP
GAKDANGSTRTLLEKMGGKPRPSGRIRSVLHADEM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TEY5	1.000	1.000	1.186E-59	395	1.000	1.000	Q8TEY5.pdb.gz	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
2	AFDB:Q9D2A5	0.479	0.508	2.106E-37	370	0.668	0.714	Q9D2A5.pdb.gz	CR3L4_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Mus musculus OX=10090 GN=Creb3l4 PE=1 SV=1
3	AFDB:Q66HA2	0.284	0.221	3.008E-9	520	0.284	0.215	Q66HA2.pdb.gz	CR3L1_RAT Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Creb3l1 PE=2 SV=1
4	AFDB:O44743	0.330	0.196	5.211E-9	690	0.241	0.138	O44743.pdb.gz	LE607_CAEEL CREB-H transcription factor homolog let-607 OS=Caenorhabditis elegans OX=6239 GN=let-607 PE=2 SV=2
5	AFDB:F4I9R1	0.209	0.219	7.775E-3	374	0.162	0.171	F4I9R1.pdb.gz	F4I9R1_ARATH Basic-leucine zipper (BZIP) transcription factor family protein OS=Arabidopsis thaliana OX=3702 GN=At1g58110 PE=1 SV=1
6	AFDB:O74757	0.066	0.042	1.257E-2	677	0.132	0.077	O74757.pdb.gz	HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrd1 PE=1 SV=1
7	AFDB:Q3UMU9	0.119	0.075	1.257E-2	669	0.114	0.067	Q3UMU9.pdb.gz	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
8	AFDB:Q9SJ62	0.090	0.084	1.347E-2	432	0.159	0.146	Q9SJ62.pdb.gz	WDL4_ARATH Protein WVD2-like 4 OS=Arabidopsis thaliana OX=3702 GN=WDL4 PE=1 SV=2
9	AFDB:M9PGV5	0.093	0.043	2.034E-2	1069	0.134	0.050	M9PGV5.pdb.gz	M9PGV5_DROME Myosin 10A, isoform E OS=Drosophila melanogaster OX=7227 GN=Myo10A PE=4 SV=1
10	AFDB:P31368	0.078	0.058	2.178E-2	601	0.119	0.078	P31368.pdb.gz	PDM1_DROME Protein nubbin OS=Drosophila melanogaster OX=7227 GN=nub PE=2 SV=1
11	PDB:3szpA	0.086	0.113	1.824	290	0.025	0.034	3szpA.pdb.gz
12	PDB:4x6gE	0.087	0.110	2.950	307	0.020	0.026	4x6gE.pdb.gz
13	PDB:5oayA	0.067	0.246	3.160	76	0.020	0.105	5oayA.pdb.gz	Structure of a Wbl protein and implications for NO sensing by M. tuberculosis.
14	PDB:3v8dA	0.046	0.039	6.279	479	0.023	0.019	3v8dA.pdb.gz	Crystal structure of human CYP7A1 in complex with 7-ketocholesterol
15	PDB:6g2jb	0.067	0.266	6.279	83	0.033	0.157	6g2jb.pdb.gz	Cryo-EM structures of complex I from mouse heart mitochondria in two biochemically defined states.
16	PDB:2v5hB	0.070	0.094	8.851	289	0.025	0.035	2v5hB.pdb.gz	The Crystal Structure of the Complex of Pii and Acetylglutamate Kinase Reveals How Pii Controls the Storage of Nitrogen as Arginine.
17	PDB:5xtcU	0.068	0.270	8.851	83	0.025	0.120	5xtcU.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
18	PDB:7qsdb	0.075	0.269	8.851	83	0.028	0.133	7qsdb.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TEY5	0.0	807	395	1.000	1.000	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
2	Q9D2A5	3.31e-176	497	370	0.668	0.714	CR3L4_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Mus musculus OX=10090 GN=Creb3l4 PE=1 SV=1
3	Q91XE9	2.00e-61	207	479	0.344	0.284	CR3L3_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Mus musculus OX=10090 GN=Creb3l3 PE=1 SV=1
4	Q68CJ9	1.29e-60	204	461	0.365	0.312	CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens OX=9606 GN=CREB3L3 PE=1 SV=2
5	O43889	5.93e-45	161	371	0.210	0.224	CREB3_HUMAN Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2
6	Q61817	1.87e-37	142	404	0.170	0.166	CREB3_MOUSE Cyclic AMP-responsive element-binding protein 3 OS=Mus musculus OX=10090 GN=Creb3 PE=2 SV=2
7	Q66HA2	8.80e-27	114	520	0.187	0.142	CR3L1_RAT Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus OX=10116 GN=Creb3l1 PE=2 SV=1
8	Q9Z125	9.53e-27	113	519	0.187	0.143	CR3L1_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Mus musculus OX=10090 GN=Creb3l1 PE=1 SV=2
9	Q96BA8	2.21e-26	112	519	0.187	0.143	CR3L1_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Homo sapiens OX=9606 GN=CREB3L1 PE=1 SV=1
10	A1L224	3.47e-26	112	519	0.197	0.150	CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio OX=7955 GN=creb3l2 PE=2 SV=1
11	O44743	9.80e-23	102	690	0.152	0.087	LE607_CAEEL CREB-H transcription factor homolog let-607 OS=Caenorhabditis elegans OX=6239 GN=let-607 PE=2 SV=2
12	Q4JFH9	2.29e-22	99.4	351	0.129	0.145	CRH2_CAEEL CREB homolog crh-2 OS=Caenorhabditis elegans OX=6239 GN=crh-2 PE=2 SV=3
13	Q8BH52	2.31e-21	97.8	521	0.180	0.136	CR3L2_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Mus musculus OX=10090 GN=Creb3l2 PE=1 SV=1
14	Q6QDP7	8.39e-21	96.3	521	0.180	0.136	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
15	Q70SY1	2.02e-20	95.1	520	0.175	0.133	CR3L2_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Homo sapiens OX=9606 GN=CREB3L2 PE=1 SV=3
16	P29747	1.95e-19	92.0	516	0.142	0.109	CREBA_DROME Cyclic AMP response element-binding protein A OS=Drosophila melanogaster OX=7227 GN=CrebA PE=1 SV=2
17	Q99941	1.94e-09	61.6	703	0.081	0.046	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
18	O35451	3.28e-09	61.2	699	0.089	0.050	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
19	G3V909	2.34e-07	55.1	656	0.084	0.050	ATF6A_RAT Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Rattus norvegicus OX=10116 GN=Atf6 PE=2 SV=1
20	F6VAN0	3.02e-07	54.7	656	0.081	0.049	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	4.8e-10	50.7	bZIP transcription factor
2	PF07716 bZIP_2	6.2e-05	34.3	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.071	25.0	bZIP Maf transcription factor
4	PF07889 DUF1664	6.6e+02	11.7	Protein of unknown function (DUF1664)
5	PF14362 DUF4407	92	13.8	Domain of unknown function (DUF4407)
6	PF01105 EMP24_GP25L	2.5e+02	13.0	emp24/gp25L/p24 family/GOLD
7	PF02183 HALZ	8.2e+02	11.6	Homeobox associated leucine zipper
8	PF14932 HAUS-augmin3	6.3e+02	11.2	HAUS augmin-like complex subunit 3
9	PF15871 JMY	3.5e+02	11.9	Junction-mediating and -regulatory protein
10	PF14662 KASH_CCD	7.2e+02	11.4	Coiled-coil region of CCDC155 or KASH
11	PF04678 MCU	8.2e+02	11.4	Mitochondrial calcium uniporter
12	PF12911 OppC_N	2.6e+02	13.0	N-terminal TM domain of oligopeptide transport permease C
13	PF06005 ZapB	3.1	19.6	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344223	0.958	Membrane-bound transcription factor site-1 protease
2	9606.ENSP00000368798	0.957	Membrane-bound transcription factor site-2 protease
3	9606.ENSP00000387699	0.907	Cyclic AMP-responsive element-binding protein 1
4	9606.ENSP00000342136	0.889	Cyclic AMP-responsive element-binding protein 3
5	9606.ENSP00000350359	0.889	Cyclic AMP-responsive element-binding protein 5
6	9606.ENSP00000309555	0.887	Host cell factor 1
7	9606.ENSP00000357622	0.861	CREB-regulated transcription coactivator 2
8	9606.ENSP00000336790	0.858	Cyclic AMP-dependent transcription factor ATF-4
9	9606.ENSP00000329140	0.847	Cyclic AMP-responsive element-binding protein 3-like protein 2
10	9606.ENSP00000481956	0.846	Cyclic AMP-responsive element-binding protein 3-like protein 1
11	9606.ENSP00000262053	0.838	Cyclic AMP-dependent transcription factor ATF-1
12	9606.ENSP00000262367	0.834	CREB-binding protein
13	9606.ENSP00000264110	0.834	Cyclic AMP-dependent transcription factor ATF-2
14	9606.ENSP00000078445	0.830	Cyclic AMP-responsive element-binding protein 3-like protein 3
15	9606.ENSP00000263253	0.830	Histone acetyltransferase p300
16	9606.ENSP00000364349	0.830	Cyclic AMP-dependent transcription factor ATF-6 beta
17	9606.ENSP00000347184	0.801	Huntingtin
18	9606.ENSP00000252996	0.800	Transcription initiation factor TFIID subunit 4
19	9606.ENSP00000269142	0.800	Transcription initiation factor TFIID subunit 4B
20	9606.ENSP00000324806	0.800	Glycogen synthase kinase-3 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0140110	0.925	transcription regulator activity
GO:0000976	0.866	transcription cis-regulatory region binding
GO:0003700	0.799	DNA-binding transcription factor activity
GO:0000981	0.562	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.492	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.471	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0008134	0.400	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0006355	0.994	regulation of DNA-templated transcription
GO:0048522	0.992	positive regulation of cellular process
GO:0010604	0.990	positive regulation of macromolecule metabolic process
GO:0031325	0.976	positive regulation of cellular metabolic process
GO:1903508	0.957	positive regulation of nucleic acid-templated transcription
GO:0045893	0.936	positive regulation of DNA-templated transcription
GO:0045944	0.925	positive regulation of transcription by RNA polymerase II
GO:0009987	0.797	cellular process
GO:0050896	0.777	response to stimulus
GO:0051716	0.674	cellular response to stimulus
GO:0006950	0.337	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.999	organelle membrane
GO:0005654	0.999	nucleoplasm
GO:0005783	0.997	endoplasmic reticulum
GO:0005794	0.994	Golgi apparatus
GO:0005829	0.971	cytosol
GO:0005739	0.883	mitochondrion
GO:0098588	0.831	bounding membrane of organelle
GO:0031967	0.500	organelle envelope
GO:0005635	0.467	nuclear envelope
GO:0000139	0.353	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]