StarFunc result for job id Q8TF05

User Input

>input (950 residues)
MADLSLLQEDLQEDADGFGVDDYSSESDVIIIPSALDFVSQDEMLTPLGRLDKYAASENI
FNRQMVARSLLDTLREVCDDERDCIAVLERISRLADDSEPTVRAELMEQVPHIALFCQEN
RPSIPYAFSKFLLPIVVRYLADQNNQVRKTSQAALLALLEQELIERFDVETKVCPVLIEL
TAPDSNDDVKTEAVAIMCKMAPMVGKDITERLILPRFCEMCCDCRMFHVRKVCAANFGDI
CSVVGQQATEEMLLPRFFQLCSDNVWGVRKACAECFMAVSCATCQEIRRTKLSALFINLI
SDPSRWVRQAAFQSLGPFISTFANPSSSGQYFKEESKSSEEMSVENKNRTRDQEAPEDVQ
VRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAAS
NENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKP
SPEGPEEESEGPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRASSLD
AHEETISIEKRSDLQDELDINELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNN
SSFSPDEERRTKVQDVVPQALLDQYLSMTDPSRAQTVDTEIAKHCAYSLPGVALTLGRQN
WHCLRETYETLASDMQWKVRRTLAFSIHELAVILGDQLTAADLVPIFNGFLKDLDEVRIG
VLKHLHDFLKLLHIDKRREYLYQLQEFLVTDNSRNWRFRAELAEQLILLLELYSPRDVYD
YLRPIALNLCADKVSSVRWISYKLVSEMVKKLHAATPPTFGVDLINELVENFGRCPKWSG
RQAFVFVCQTVIEDDCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKDYFL
ASASCHQEAVEQTIMALQMDRDSDVKYFASIHPASTKISEDAMSTASSTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF05	1.000	1.000	9.228E-104	950	1.000	1.000	Q8TF05.pdb.gz	PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1
2	AFDB:F1MRS1	0.659	0.700	7.360E-83	893	0.802	0.853	F1MRS1.pdb.gz	F1MRS1_BOVIN Protein phosphatase 4 regulatory subunit 1 OS=Bos taurus OX=9913 GN=PPP4R1 PE=1 SV=3
3	PDB:1b3uA	0.369	0.549	4.125E-14	588	0.138	0.223	1b3uA.pdb.gz
4	PDB:7k36A	0.391	0.614	2.204E-8	554	0.125	0.215	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
5	PDB:6xu2A	0.188	0.172	5.905E-8	1091	0.114	0.099	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
6	PDB:4a0cA	0.346	0.296	7.137E-8	1155	0.109	0.090	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
7	AFDB:Q6A070	0.213	0.134	8.650E-8	1776	0.176	0.094	Q6A070.pdb.gz	TGRM1_MOUSE TOG array regulator of axonemal microtubules protein 1 OS=Mus musculus OX=10090 GN=Togaram1 PE=1 SV=3
8	PDB:3w3uA	0.319	0.300	9.664E-8	1030	0.109	0.101	3w3uA.pdb.gz
9	PDB:2q5dB	0.325	0.358	3.641E-7	845	0.092	0.103	2q5dB.pdb.gz	Molecular Basis for the Recognition of Snurportin 1 by Importin {beta}.
10	PDB:7unkA	0.224	0.207	4.571E-7	1047	0.112	0.101	7unkA.pdb.gz
11	PDB:1qgkA	0.336	0.360	4.931E-7	876	0.100	0.108	1qgkA.pdb.gz
12	PDB:4jlqA	0.361	0.401	5.319E-7	840	0.106	0.120	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
13	AFDB:Q95YF0	0.189	0.136	5.976E-7	1378	0.137	0.094	Q95YF0.pdb.gz	CLAP1_CAEEL Protein CLASP-1 OS=Caenorhabditis elegans OX=6239 GN=cls-1 PE=3 SV=1
14	AFDB:Q9Y4F4	0.199	0.129	7.223E-7	1720	0.172	0.095	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
15	PDB:3w3zA	0.272	0.261	9.391E-7	1013	0.100	0.094	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
16	AFDB:Q9T041	0.228	0.248	5.183E-6	864	0.136	0.149	Q9T041.pdb.gz	TOR1_ARATH Microtubule-associated protein TORTIFOLIA1 OS=Arabidopsis thaliana OX=3702 GN=TOR1 PE=1 SV=2
17	AFDB:E3W994	0.171	0.136	2.546E-5	1273	0.139	0.104	E3W994.pdb.gz	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
18	AFDB:Q92574	0.169	0.145	3.789E-3	1164	0.161	0.131	Q92574.pdb.gz	TSC1_HUMAN Hamartin OS=Homo sapiens OX=9606 GN=TSC1 PE=1 SV=2
19	AFDB:Q9Z136	0.150	0.128	4.409E-3	1163	0.154	0.126	Q9Z136.pdb.gz	TSC1_RAT Hamartin OS=Rattus norvegicus OX=10116 GN=Tsc1 PE=1 SV=1
20	AFDB:A0A2R8QQL1	0.122	0.109	1.427E-2	1108	0.091	0.078	A0A2R8QQL1.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1MRS1	0.0	1528	893	0.804	0.856	F1MRS1_BOVIN Protein phosphatase 4 regulatory subunit 1 OS=Bos taurus OX=9913 GN=PPP4R1 PE=1 SV=3
2	Q8TF05	0.0	1957	950	1.000	1.000	PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1 PE=1 SV=1
3	Q9P1A2	1.69e-107	341	415	0.180	0.412	PP4RL_HUMAN Putative serine/threonine-protein phosphatase 4 regulatory subunit 1-like OS=Homo sapiens OX=9606 GN=PPP4R1L PE=5 SV=3
4	G5ECH5	8.24e-39	159	1562	0.105	0.064	PP4R1_CAEEL Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ppfr-1 PE=1 SV=1
5	Q38950	3.45e-11	69.3	587	0.078	0.126	2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA2 PE=1 SV=2
6	Q32PI5	1.14e-10	67.8	589	0.080	0.129	2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus OX=9913 GN=PPP2R1A PE=1 SV=1
7	A8K7B7	1.52e-10	67.4	589	0.080	0.129	A8K7B7_HUMAN Protein phosphatase 2 (Formerly 2A), regulatory subunit A (PR 65), alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=1
8	P30153	1.52e-10	67.4	589	0.080	0.129	2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4
9	Q76MZ3	1.55e-10	67.4	589	0.080	0.129	2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r1a PE=1 SV=3
10	Q38951	3.27e-10	66.2	587	0.076	0.123	2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA3 PE=1 SV=2
11	Q09543	3.55e-10	66.2	590	0.077	0.124	2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=paa-1 PE=1 SV=2
12	Q38845	5.83e-10	65.5	588	0.078	0.126	2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AA1 PE=1 SV=1
13	Q9UT08	1.53e-08	60.8	590	0.095	0.153	2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=paa1 PE=1 SV=1
14	Q7TNP2	2.17e-08	60.5	601	0.071	0.111	2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus OX=10090 GN=Ppp2r1b PE=1 SV=2
15	P30154	2.67e-08	60.1	601	0.071	0.111	2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B PE=1 SV=3
16	P36179	2.90e-07	56.6	591	0.042	0.068	2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pp2A-29B PE=1 SV=4
17	Q54QR9	2.46e-06	53.9	584	0.077	0.125	2AAA_DICDI Protein phosphatase 2A scaffold subunit OS=Dictyostelium discoideum OX=44689 GN=pppA PE=1 SV=1
18	A6MUT0	2.87e-06	52.0	245	0.052	0.200	A6MUT0_GOSHI Protein phosphatase (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=1
19	Q5ADN1	4.35e-06	53.1	643	0.057	0.084	Q5ADN1_CANAL Protein phosphatase 2A structural subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPD3 PE=4 SV=1
20	P31383	2.25e-04	47.4	635	0.069	0.104	2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPD3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	0.38	22.3	non-SMC mitotic condensation complex subunit 1
2	PF02985 HEAT	5.4e-23	90.1	HEAT repeat
3	PF13646 HEAT_2	3e-11	54.9	HEAT repeats
4	PF14663 RasGEF_N_2	5.6e+02	12.4	Rapamycin-insensitive companion of mTOR RasGEF_N domain
5	PF12755 Vac14_Fab1_bd	17	17.5	Vacuolar 14 Fab1-binding region
6	PF15017 WRNPLPNID	0.0021	30.2	Putative WW-binding domain and destruction box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000279387	0.999	Serine/threonine-protein phosphatase 4 catalytic subunit
2	9606.ENSP00000349124	0.986	Serine/threonine-protein phosphatase 4 regulatory subunit 2
3	9606.ENSP00000221138	0.979	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
4	9606.ENSP00000418447	0.962	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
5	9606.ENSP00000377036	0.960	Serine/threonine-protein phosphatase 2A activator
6	9606.ENSP00000305924	0.942	Serine/threonine-protein phosphatase 4 regulatory subunit 4
7	9606.ENSP00000325074	0.878	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
8	9606.ENSP00000399970	0.877	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
9	9606.ENSP00000412324	0.852	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
10	9606.ENSP00000261461	0.843	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
11	9606.ENSP00000263102	0.833	Coiled-coil domain containing 6
12	9606.ENSP00000341779	0.831	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
13	9606.ENSP00000311344	0.824	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
14	9606.ENSP00000326031	0.823	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
15	9606.ENSP00000378769	0.820	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
16	9606.ENSP00000378323	0.817	Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
17	9606.ENSP00000264977	0.816	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
18	9606.ENSP00000375080	0.804	Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
19	9606.ENSP00000378306	0.803	Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform
20	9606.ENSP00000234310	0.798	Calcineurin subunit B type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.970	cellular process
GO:0080090	0.929	regulation of primary metabolic process
GO:0051171	0.915	regulation of nitrogen compound metabolic process
GO:0031323	0.867	regulation of cellular metabolic process
GO:0060255	0.796	regulation of macromolecule metabolic process
GO:0048519	0.567	negative regulation of biological process
GO:0048523	0.530	negative regulation of cellular process
GO:0008152	0.507	metabolic process
GO:0071704	0.479	organic substance metabolic process
GO:0051246	0.431	regulation of protein metabolic process
GO:0048518	0.414	positive regulation of biological process
GO:0044238	0.408	primary metabolic process
GO:0048522	0.392	positive regulation of cellular process
GO:0006807	0.370	nitrogen compound metabolic process
GO:0043170	0.317	macromolecule metabolic process
GO:1901564	0.307	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.984	protein-containing complex
GO:0005829	0.968	cytosol
GO:0008287	0.948	protein serine/threonine phosphatase complex
GO:0005634	0.884	nucleus
GO:0043233	0.701	organelle lumen
GO:0070013	0.693	intracellular organelle lumen
GO:0031981	0.394	nuclear lumen
GO:0005654	0.348	nucleoplasm
GO:0016020	0.335	membrane
GO:0043232	0.322	intracellular non-membrane-bounded organelle
GO:0071944	0.320	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]