StarFunc result for job id Q8TF17

User Input

>input (1288 residues)
MGGCFCIPRERSLTRGPGKETPSKDPTVSSECIASSEYKEKCFLPQNINPDLTLSFCVKS
RSRRCVNGPLQEAARRRLWALENEDQEVRMLFKDLSARLVSIQSQRAQFLITFKTMEEIW
KFSTYLNLGYVSMCLEHLLFDHKYWLNCILVEDTEIQVSVDDKHLETIYLGLLIQEGHFF
CRALCSVTPPAEKEGECLTLCKNELISVKMAEAGSELEGVSLVTGQRGLVLVSALEPLPL
PFHQWFLKNYPGSCGLSRKRDWTGSYQIGRGRCKALTGYEPGEKDELNFYQGESIEIIGF
VIPGLQWFIGKSTSSGQVGFVPTRNIDPDSYSPMSRNSAFLSDEERCSLLALGSDKQTEC
SSFLHTLARTDITSVYRLSGFESIQNPPNDLSASQPEGFKEVRPGRAWEEHQAVGSRQSS
SSEDSSLEEELLSATSDSYRLPEPDDLDDPELLMDLSTGQEEEAENFAPILAFLDHEGYA
DHFKSLYDFSFSFLTSSFYSFSEEDEFVAYLEASRKWAKKSHMTWAHARLCFLLGRLSIR
KVKLSQARVYFEEAIHILNGAFEDLSLVATLYINLAAIYLKQRLRHKGSALLEKAGALLA
CLPDRESSAKHELDVVAYVLRQGIVVGSSPLEARACFLAIRLLLSLGRHEEVLPFAERLQ
LLSGHPPASEAVASVLSFLYDKKYLPHLAVASVQQHGIQSAQGMSLPIWQVHLVLQNTTK
LLGFPSPGWGEVSALACPMLRQALAACEELADRSTQRALCLILSKVYLEHRSPDGAIHYL
SQALVLGQLLGEQESFESSLCLAWAYLLASQAKKALDVLEPLLCSLKETESLTQRGVIYN
LLGLALQGEGRVNRAAKSYLRALNRAQEVGDVHNQAVAMANLGHLSLKSWAQHPARNYLL
QAVRLYCELQASKETDMELVQVFLWLAQVLVSGHQLTHGLLCYEMALLFGLRHRHLKSQL
QATKSLCHFYSSVSPNPEACITYHEHWLALAQQLRDREMEGRLLESLGQLYRNLNTARSL
RRSLTCIKESLRIFIDLGETDKAAEAWLGAGRLHYLMQEDELVELCLQAAIQTALKSEEP
LLALKLYEEAGDVFFNGTRHRHHAVEYYRAGAVPLARRLKAVRTELRIFNKLTELQISLE
GYEKALEFATLAARLSTVTGDQRQELVAFHRLATVYYSLHMYEMAEDCYLKTLSLCPPWL
QSPKEALYYAKVYYRLGRLTFCQLKDAHDATEYFLLALAAAVLLGDEELQDTIRSRLDNI
CQSPLWHSRPSGCSSERARWLSGGGLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80VA5	0.941	0.940	0.000	1289	0.818	0.817	Q80VA5.pdb.gz	S3TC2_MOUSE SH3 domain and tetratricopeptide repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Sh3tc2 PE=1 SV=2
2	AFDB:Q96AY4	0.271	0.158	7.139E-19	2481	0.135	0.070	Q96AY4.pdb.gz	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
3	AFDB:Q0HA38	0.209	0.206	7.092E-11	1315	0.104	0.102	Q0HA38.pdb.gz	TT21B_MOUSE Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1
4	AFDB:Q7Z4L5	0.187	0.184	1.104E-9	1316	0.102	0.100	Q7Z4L5.pdb.gz	TT21B_HUMAN Tetratricopeptide repeat protein 21B OS=Homo sapiens OX=9606 GN=TTC21B PE=1 SV=2
5	PDB:4bujB	0.113	0.110	1.618E-9	1367	0.093	0.088	4bujB.pdb.gz
6	AFDB:Q9FPW0	0.158	0.225	5.474E-9	782	0.085	0.141	Q9FPW0.pdb.gz	Q9FPW0_CHLRE Intraflagellar transport particle protein IFT88 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT88 PE=2 SV=1
7	AFDB:A0A2R8QRB2	0.183	0.256	6.624E-9	795	0.081	0.131	A0A2R8QRB2.pdb.gz
8	AFDB:Q57WP4	0.218	0.370	8.014E-9	673	0.078	0.150	Q57WP4.pdb.gz	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
9	AFDB:Q62018	0.127	0.135	8.986E-9	1173	0.099	0.108	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
10	AFDB:O81629	0.189	0.372	1.316E-8	609	0.054	0.115	O81629.pdb.gz	KLCR1_ARATH Protein KINESIN LIGHT CHAIN-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=KLCR1 PE=1 SV=1
11	AFDB:Q9HZE5	0.177	0.189	1.718E-8	1193	0.095	0.103	Q9HZE5.pdb.gz	Q9HZE5_PSEAE PelB OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pelB PE=1 SV=1
12	PDB:6tedQ	0.174	0.228	4.636E-8	890	0.090	0.130	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	PDB:7qdrB	0.166	0.174	6.289E-8	1212	0.105	0.111	7qdrB.pdb.gz
14	PDB:7dkhI	0.176	0.223	6.788E-8	914	0.094	0.132	7dkhI.pdb.gz
15	PDB:7ntfA	0.190	0.244	4.928E-7	918	0.068	0.095	7ntfA.pdb.gz
16	PDB:6bq1B	0.157	0.229	6.195E-7	728	0.085	0.151	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
17	PDB:5dseA	0.192	0.382	7.215E-7	537	0.076	0.182	5dseA.pdb.gz
18	PDB:7qe7Y	0.183	0.385	1.097E-6	502	0.060	0.153	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:7sqcR1	0.195	0.152	1.230E-6	2080	0.097	0.060	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:8a3tJ	0.152	0.354	1.230E-6	509	0.055	0.139	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80VA5	0.0	2062	1289	0.817	0.816	S3TC2_MOUSE SH3 domain and tetratricopeptide repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Sh3tc2 PE=1 SV=2
2	Q96AY4	3.91e-06	54.3	2481	0.080	0.042	TTC28_HUMAN Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4
3	F6QN66	3.94e-06	54.3	2481	0.080	0.042	F6QN66_MACMU Tetratricopeptide repeat domain 28 OS=Macaca mulatta OX=9544 GN=TTC28 PE=4 SV=1
4	Q9R080	1.69e-04	48.5	673	0.049	0.094	GPSM1_RAT G-protein-signaling modulator 1 OS=Rattus norvegicus OX=10116 GN=Gpsm1 PE=1 SV=2
5	Q6IR34	1.87e-04	48.1	673	0.049	0.094	GPSM1_MOUSE G-protein-signaling modulator 1 OS=Mus musculus OX=10090 GN=Gpsm1 PE=1 SV=3
6	A0A0A0MRC4	0.008	42.7	707	0.041	0.075	A0A0A0MRC4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
7	A0A0A0MSK4	0.009	42.7	675	0.041	0.079	A0A0A0MSK4_HUMAN G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=1
8	Q6XZF7	0.010	42.7	1577	0.040	0.033	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
9	Q86YR5	0.010	42.7	675	0.041	0.079	GPSM1_HUMAN G-protein-signaling modulator 1 OS=Homo sapiens OX=9606 GN=GPSM1 PE=1 SV=2
10	Q6TXD4	0.012	42.7	1580	0.044	0.036	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
11	E7F1U2	0.015	42.4	1673	0.036	0.027	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
12	W5U6C9	0.016	42.0	500	0.019	0.050	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
13	M0R4F8	0.035	41.2	1577	0.044	0.036	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
14	A8WFV6	0.041	40.4	537	0.020	0.048	A8WFV6_DANRE Nostrin OS=Danio rerio OX=7955 GN=nostrin PE=2 SV=1
15	Q8VDU0	0.047	40.4	679	0.051	0.097	GPSM2_MOUSE G-protein-signaling modulator 2 OS=Mus musculus OX=10090 GN=Gpsm2 PE=1 SV=2
16	Q9NFR7	0.052	40.4	658	0.044	0.087	Q9NFR7_DROME Rapsynoid OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
17	Q9NH88	0.057	40.0	658	0.044	0.087	Q9NH88_DROME Partner of Inscuteable OS=Drosophila melanogaster OX=7227 GN=pins PE=2 SV=1
18	Q9VB22	0.074	39.7	658	0.044	0.087	Q9VB22_DROME LD33695p OS=Drosophila melanogaster OX=7227 GN=pins PE=1 SV=1
19	P81274	0.094	39.7	684	0.042	0.079	GPSM2_HUMAN G-protein-signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=3
20	H0Y4A4	0.099	39.3	627	0.042	0.086	H0Y4A4_HUMAN G protein signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16734 Pilin_GH	4.2e+02	12.6	Type IV pilin-like G and H, putative
2	PF00018 SH3_1	0.002	29.0	SH3 domain
3	PF07653 SH3_2	0.0005	31.1	Variant SH3 domain
4	PF14604 SH3_9	0.068	24.4	Variant SH3 domain
5	PF14938 SNAP	0.031	25.3	Soluble NSF attachment protein, SNAP
6	PF00515 TPR_1	0.028	25.4	Tetratricopeptide repeat
7	PF13374 TPR_10	1.3e+02	13.9	Tetratricopeptide repeat
8	PF13424 TPR_12	6.3e-09	47.3	Tetratricopeptide repeat
9	PF07719 TPR_2	10	17.6	Tetratricopeptide repeat
10	PF13181 TPR_8	0.021	26.0	Tetratricopeptide repeat
11	PF17874 TPR_MalT	17	16.2	MalT-like TPR region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000423660

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256190	0.875	Myotubularin-related protein 13
2	9606.ENSP00000459533	0.872	Lipopolysaccharide-induced tumor necrosis factor-alpha factor
3	9606.ENSP00000345752	0.865	Myotubularin-related protein 2
4	9606.ENSP00000261890	0.860	Ras-related protein Rab-11A
5	9606.ENSP00000220822	0.842	Ganglioside-induced differentiation-associated protein 1
6	9606.ENSP00000230124	0.821	Polyphosphoinositide phosphatase
7	9606.ENSP00000394487	0.793	FYVE, RhoGEF and PH domain-containing protein 4
8	9606.ENSP00000432943	0.753	Myelin protein P0
9	9606.ENSP00000363134	0.714	Gap junction beta-1 protein
10	9606.ENSP00000404854	0.673	Protein NDRG1
11	9606.ENSP00000255078	0.661	DNA-binding protein SMUBP-2
12	9606.ENSP00000370196	0.661	Myotubularin-related protein 5
13	9606.ENSP00000322937	0.654	E3 ubiquitin-protein ligase LRSAM1
14	9606.ENSP00000264638	0.626	Contactin-associated protein 1
15	9606.ENSP00000235329	0.616	Mitofusin-2
16	9606.ENSP00000242480	0.609	E3 SUMO-protein ligase EGR2
17	9606.ENSP00000373918	0.608	Glycine--tRNA ligase
18	9606.ENSP00000482169	0.606	Neurofilament light polypeptide
19	9606.ENSP00000373905	0.587	Dynamin-2
20	9606.ENSP00000237014	0.572	Transthyretin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0007272	0.988	ensheathment of neurons
GO:0071840	0.965	cellular component organization or biogenesis
GO:0016043	0.964	cellular component organization
GO:0008366	0.961	axon ensheathment
GO:0007422	0.960	peripheral nervous system development
GO:0032292	0.943	peripheral nervous system axon ensheathment
GO:0042552	0.940	myelination
GO:0021782	0.940	glial cell development
GO:0014037	0.940	Schwann cell differentiation
GO:0010256	0.935	endomembrane system organization
GO:0014044	0.924	Schwann cell development
GO:0022011	0.881	myelination in peripheral nervous system
GO:0048583	0.634	regulation of response to stimulus
GO:0010646	0.592	regulation of cell communication
GO:0023051	0.574	regulation of signaling
GO:0051049	0.558	regulation of transport
GO:0009966	0.552	regulation of signal transduction
GO:0060341	0.485	regulation of cellular localization
GO:1901184	0.474	regulation of ERBB signaling pathway
GO:0032386	0.473	regulation of intracellular transport
GO:0061024	0.400	membrane organization
GO:0032880	0.376	regulation of protein localization
GO:0070201	0.372	regulation of establishment of protein localization
GO:0033157	0.363	regulation of intracellular protein transport
GO:0007009	0.358	plasma membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0031410	0.996	cytoplasmic vesicle
GO:0005829	0.842	cytosol
GO:0043228	0.625	non-membrane-bounded organelle
GO:0043232	0.615	intracellular non-membrane-bounded organelle
GO:0032991	0.511	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]