StarFunc result for job id Q8TF21

User Input

>input (1146 residues)
MKTLRARFKKTELRLSPTDLGSCPPCGPCPIPKPAARGRRQSQDWGKSDERLLQAVENND
APRVAALIARKGLVPTKLDPEGKSAFHLAAMRGAASCLEVMIAHGSNVMSADGAGYNALH
LAAKYGHPQCLKQLLQASCVVDVVDSSGWTALHHAAAGGCLSCSEVLCSFKAHLNPQDRS
GATPLIIAAQMCHTDLCRLLLQQGAAANDQDLQGRTALMLACEGASPETVEVLLQGGAQP
GITDALGQDAAHYGALAGDKLILHLLQEAAQRPSPPSALTEDDSGEASSQNSMSSHGKQG
APKKRKAPPPPASIPMPDDRDAYEEIVRLRQERGRLLQKIRGLEQHKERRQQESPEASSL
HILERQVQELQQLLVERQEEKESLGREVESLQSRLSLLENERENTSYDVTTLQDEEGELP
DLPGAEVLLSRQLSPSAQEHLASLQEQVAVLTRQNQELMEKVQILENFEKDETQMEVEAL
AEVIPLALYDSLRAEFDQLRRQHAEALQALRQQETREVPREEGAACGESEVAGATATKNG
PTHMELNGSVAPETKVNGAETIDEEAAGDETMEARTMEAEATGAEATGAEATGAKVTETK
PTGAEVREMETTEEEANMETKPTGAQATDTETTGVEAMGVEATKTKAEEAEMQAYGVGAG
QAEPPVTGTTNMEATGSRATGMESTGVSATGVENPGVEATVPGISAGPILHPGAAEASEK
LQVELETRIRGLEEALRQREREAAAELEAALGKCEAAEAEAGRLRERVREAEGSGASGGG
GGDTTQLRAALEQAREDLRDRDSRLRELEAASACLDEARASRLLAEEEARGLRAELAQRE
EARLEQSRELEVLREQLATARATGEQQRTAAAELGRARDAAEARVAELPAACEEARQGLA
ELREASEALRQSVVPASEHRRLQEEALELRGRAASLEQEVVATGKEAARLRAELERERVC
SVALSEHERIVGTLQANVAQLEGQLEELGRRHEKTSAEVFQVQREALFMKSERHAAEAQL
ATAEQQLRGLRTEAERARQAQSRAQEALDKAKEKDKKITELSKEVFNLKEALKEQPAALA
TPEVEALRDQVKDLQQQLQEAARDHSSVVALYRSHLLYAIQGQMDEDVQRILSQILQMQR
LQAQGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9EP71	0.201	0.234	5.406E-30	979	0.266	0.312	Q9EP71.pdb.gz	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
2	AFDB:Q9P0K7	0.196	0.229	1.763E-29	980	0.248	0.290	Q9P0K7.pdb.gz	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
3	AFDB:Q9ULJ7	0.123	0.104	3.882E-14	1429	0.099	0.080	Q9ULJ7.pdb.gz	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
4	AFDB:Q5TYW2	0.202	0.274	8.035E-14	823	0.145	0.202	Q5TYW2.pdb.gz	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
5	AFDB:A0A0R4IA11	0.190	0.381	1.821E-13	563	0.059	0.121	A0A0R4IA11.pdb.gz
6	AFDB:A1A5B0	0.196	0.682	3.143E-13	309	0.053	0.197	A1A5B0.pdb.gz	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
7	AFDB:O15084	0.183	0.199	4.321E-13	1053	0.066	0.072	O15084.pdb.gz	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
8	AFDB:P97582	0.188	0.254	6.217E-13	843	0.052	0.071	P97582.pdb.gz	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
9	AFDB:Q80YE7	0.192	0.153	7.456E-13	1442	0.055	0.044	Q80YE7.pdb.gz	DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus OX=10090 GN=Dapk1 PE=1 SV=3
10	AFDB:Q8N8A2	0.184	0.212	1.025E-12	993	0.065	0.076	Q8N8A2.pdb.gz	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
11	PDB:2dvwA	0.187	0.873	3.849E-12	229	0.050	0.249	2dvwA.pdb.gz
12	PDB:8cs9A	0.189	0.270	8.726E-12	796	0.053	0.077	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:6v9hC	0.179	0.709	1.921E-10	270	0.048	0.204	6v9hC.pdb.gz
14	PDB:4oauC	0.156	0.241	2.764E-10	692	0.055	0.091	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:1wg0A	0.183	0.792	6.862E-10	243	0.046	0.218	1wg0A.pdb.gz
16	PDB:6aunA	0.149	0.252	1.003E-8	618	0.044	0.081	6aunA.pdb.gz
17	PDB:5vkqA	0.157	0.124	1.654E-8	1499	0.062	0.047	5vkqA.pdb.gz
18	PDB:6jd6B	0.141	0.784	3.425E-8	192	0.038	0.224	6jd6B.pdb.gz
19	PDB:1bd8A	0.120	0.725	4.572E-7	156	0.039	0.288	1bd8A.pdb.gz
20	PDB:6mwqA	0.128	0.285	4.785E-7	493	0.047	0.110	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CGB3	1.13e-68	255	1411	0.127	0.103	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
2	Q9P0K7	1.46e-67	248	980	0.107	0.126	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
3	Q9EP71	3.51e-67	247	979	0.106	0.124	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
4	Q9BZF9	9.48e-65	243	1416	0.121	0.098	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
5	H0YNH8	1.61e-64	242	1401	0.118	0.096	H0YNH8_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
6	F5H2B9	7.97e-36	150	1307	0.062	0.054	F5H2B9_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
7	Q8N8A2	1.32e-19	97.8	993	0.066	0.077	ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens OX=9606 GN=ANKRD44 PE=1 SV=3
8	A0A0G2KAS9	3.48e-19	97.1	3980	0.052	0.015	A0A0G2KAS9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
9	F6NQ86	3.79e-19	92.4	336	0.055	0.188	F6NQ86_DANRE Fibronectin type III and ankyrin repeat domains 1 OS=Danio rerio OX=7955 GN=fank1 PE=4 SV=1
10	A0A0G2JZ56	3.92e-19	96.7	4013	0.052	0.015	A0A0G2JZ56_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
11	Q8C8R3	4.22e-19	96.7	3898	0.052	0.015	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2
12	A0A0G2K6R9	4.27e-19	96.7	3998	0.052	0.015	A0A0G2K6R9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
13	F1M9N9	4.34e-19	96.7	3977	0.052	0.015	F1M9N9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
14	F1LM42	5.10e-19	96.3	4021	0.052	0.015	F1LM42_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
15	A0A0G2KBB9	5.32e-19	96.3	4017	0.052	0.015	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
16	A0A5F9ZHS1	6.08e-19	95.9	3984	0.052	0.015	A0A5F9ZHS1_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
17	A0A5F9ZGX3	6.18e-19	95.9	3972	0.052	0.015	A0A5F9ZGX3_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
18	A0A5F9ZHR8	6.23e-19	95.9	3939	0.052	0.015	A0A5F9ZHR8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
19	A0A5F9ZHE4	6.78e-19	95.9	3964	0.052	0.015	A0A5F9ZHE4_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	I6L894	6.83e-19	95.9	3924	0.052	0.015	I6L894_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.7e-15	67.9	Ankyrin repeat
2	PF12796 Ank_2	3.7e-29	112.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	8.3e-13	58.1	Ankyrin repeat
4	PF13637 Ank_4	4.1e-18	76.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4.2e-18	76.4	Ankyrin repeats (many copies)
6	PF07989 Cnn_1N	8.2	18.0	Centrosomin N-terminal motif 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000471252

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000439182	0.637	Unconventional myosin-Ih
2	9606.ENSP00000258111	0.620	Calcium-activated potassium channel subunit beta-4
3	9606.ENSP00000319254	0.607	PDZ domain-containing protein GIPC3
4	9606.ENSP00000382670	0.606	Glutaredoxin domain-containing cysteine-rich protein 1
5	9606.ENSP00000386213	0.592	Myosin-IIIb
6	9606.ENSP00000383115	0.574	Collectin-12
7	9606.ENSP00000265944	0.549	Myosin-IIIa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050789	0.982	regulation of biological process
GO:0050794	0.969	regulation of cellular process
GO:0050896	0.394	response to stimulus
GO:0032501	0.388	multicellular organismal process
GO:0051179	0.359	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0016020	0.996	membrane
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0005886	0.960	plasma membrane
GO:0005829	0.924	cytosol
GO:0005856	0.910	cytoskeleton
GO:0005634	0.841	nucleus
GO:0070013	0.690	intracellular organelle lumen
GO:0031981	0.679	nuclear lumen
GO:0032991	0.403	protein-containing complex
GO:0015630	0.389	microtubule cytoskeleton
GO:0005654	0.359	nucleoplasm
GO:0015629	0.313	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]