StarFunc result for job id Q8TF27

User Input

>input (550 residues)
MTIISVTLEIHHHITERDADRSLTILDEQLYSFAFSTVHITKKRNGGGSLNNYSSSIPLT
PSTSQEDLYFSVPPTANTPTPICKQSMGWSNLFTSEKGSDPDKGRKALESHADTIGSGRA
IPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLRTSTIKVP
GKWPSLATSACAPISSSKSNGLSKDMEALHMSANSDIGLGDSICFSPSISSTTSPKLNLP
PSPHANKKKHLKKKSTNNLKDDGLSSTAEEEEEKFMIVSVTGQTCHFKATTYEERDAWVQ
AIQSQILASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNSHCVDCETQNPKWASLNLGV
LMCIECSGIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKPSI
ESTREEKERWIRSKYEHKLFLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSREEVN
ETCGEGDGCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVL
LQYGCPDECV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPQ3	0.526	0.355	8.258E-64	857	0.778	0.499	Q9UPQ3.pdb.gz	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
2	AFDB:Q8VHH5	0.561	0.354	4.884E-54	910	0.571	0.345	Q8VHH5.pdb.gz	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
3	AFDB:A0A024RB55	0.626	0.425	1.024E-47	836	0.484	0.318	A0A024RB55.pdb.gz
4	AFDB:Q8WZ64	0.280	0.103	2.257E-15	1704	0.187	0.060	Q8WZ64.pdb.gz	ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ARAP2 PE=1 SV=3
5	AFDB:F1LM60	0.313	0.124	4.191E-14	1443	0.171	0.065	F1LM60.pdb.gz	F1LM60_RAT ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1 OS=Rattus norvegicus OX=10116 GN=Arap1 PE=1 SV=1
6	PDB:3lvqE	0.354	0.457	2.639E-13	420	0.136	0.179	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
7	PDB:3ljuX	0.212	0.309	4.709E-9	373	0.076	0.113	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
8	PDB:3o47A	0.145	0.270	8.372E-6	289	0.060	0.114	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
9	PDB:8cs9A	0.164	0.115	3.354E-4	796	0.062	0.043	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
10	PDB:6v9hC	0.155	0.311	4.561E-4	270	0.045	0.093	6v9hC.pdb.gz
11	AFDB:A8TT22	0.177	0.094	7.656E-4	1173	0.162	0.076	A8TT22.pdb.gz	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
12	PDB:4oauC	0.169	0.134	1.090E-3	692	0.053	0.042	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
13	PDB:6jd6B	0.161	0.447	1.271E-3	192	0.044	0.125	6jd6B.pdb.gz
14	PDB:6mwqA	0.170	0.190	2.742E-3	493	0.062	0.069	6mwqA.pdb.gz
15	PDB:4bszB	0.157	0.525	3.544E-3	150	0.053	0.193	4bszB.pdb.gz
16	PDB:3ehqA	0.157	0.452	4.819E-3	182	0.040	0.121	3ehqA.pdb.gz
17	AFDB:Q5H9F3	0.147	0.049	5.948E-3	1711	0.151	0.049	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
18	AFDB:X1WE18	0.165	0.088	4.864E-2	1085	0.136	0.069	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
19	AFDB:A1DRY3	0.158	0.114	7.715E-2	782	0.142	0.100	A1DRY3.pdb.gz	A1DRY3_HUMAN Several ankyrin repeat protein transcript variant 2 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
20	AFDB:A2ABF9	0.177	0.080	1.502E-1	1267	0.155	0.067	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8VHH5	0.0	574	910	0.553	0.334	AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Agap3 PE=1 SV=1
2	Q9UPQ3	0.0	803	857	0.775	0.497	AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=AGAP1 PE=1 SV=4
3	U6A022	0.0	565	808	0.527	0.359	U6A022_RAT ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 OS=Rattus norvegicus OX=10116 GN=Agap3 PE=2 SV=1
4	J3KNM6	1.37e-155	473	1036	0.462	0.245	J3KNM6_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 (Fragment) OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
5	F8VVT9	2.27e-149	461	1192	0.462	0.213	F8VVT9_HUMAN ArfGAP with GTPase domain, ankyrin repeat and PH domain 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=1
6	Q99490	3.25e-149	460	1192	0.462	0.213	AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=AGAP2 PE=1 SV=2
7	Q3UHD9	5.18e-143	444	1186	0.458	0.212	AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Agap2 PE=1 SV=1
8	Q8CGU4	8.68e-143	443	1186	0.458	0.212	AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Agap2 PE=1 SV=1
9	A0JMI1	1.14e-133	410	827	0.451	0.300	A0JMI1_DANRE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Danio rerio OX=7955 GN=agap2 PE=2 SV=1
10	Q9NGC3	2.48e-100	327	995	0.369	0.204	CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster OX=7227 GN=CenG1A PE=2 SV=2
11	Q9XX14	1.32e-81	278	1107	0.349	0.173	CNT2_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-2 OS=Caenorhabditis elegans OX=6239 GN=cnt-2 PE=1 SV=2
12	Q54WI0	8.82e-39	154	1333	0.215	0.089	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
13	Q4QQN0	2.05e-36	145	626	0.164	0.144	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
14	Q3UH98	4.83e-36	145	833	0.151	0.100	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	Q6NXL5	4.92e-36	145	833	0.151	0.100	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
16	A2ADA6	4.93e-36	145	829	0.151	0.100	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
17	Q5FVC7	2.85e-32	134	770	0.138	0.099	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
18	Q15057	4.45e-32	133	778	0.136	0.096	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
19	Q6ZQK5	7.24e-32	132	770	0.136	0.097	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
20	Q15027	3.36e-30	127	740	0.182	0.135	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2e-06	39.2	Ankyrin repeat
2	PF12796 Ank_2	1.4e-06	40.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.63	21.6	Ankyrin repeat
4	PF13637 Ank_4	0.0024	29.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	9e-06	37.1	Ankyrin repeats (many copies)
6	PF01412 ArfGap	1.1e-33	127.2	Putative GTPase activating protein for Arf
7	PF16663 MAGI_u1	41	15.5	Unstructured region on MAGI
8	PF12814 Mcp5_PH	7.3e+02	11.8	Meiotic cell cortex C-terminal pleckstrin homology
9	PF00169 PH	8.8e-08	44.0	PH domain
10	PF15413 PH_11	0.01	27.6	Pleckstrin homology domain
11	PF16652 PH_13	1.3e+02	13.9	Pleckstrin homology domain
12	PF15404 PH_4	0.94	20.8	Pleckstrin homology domain
13	PF15406 PH_6	0.069	24.8	Pleckstrin homology domain
14	PF15409 PH_8	27	16.4	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342790	0.605	Family with sequence similarity 25 member A
2	9606.ENSP00000485370	0.556	Protein FAM25A
3	9606.ENSP00000361097	0.518	Multimerin-2
4	9606.ENSP00000310182	0.502	Uncharacterized protein FAM241A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005543	0.999	phospholipid binding
GO:0035091	0.991	phosphatidylinositol binding
GO:0043167	0.986	ion binding
GO:1901981	0.978	phosphatidylinositol phosphate binding
GO:0043168	0.744	anion binding
GO:0005547	0.548	phosphatidylinositol-3,4,5-trisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.752	anatomical structure development
GO:0009987	0.472	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.982	membrane
GO:0005634	0.900	nucleus
GO:0071944	0.889	cell periphery
GO:0005886	0.571	plasma membrane
GO:0012505	0.558	endomembrane system
GO:0005829	0.401	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]