StarFunc result for job id Q8TF30

User Input

>input (809 residues)
MEDEQPDSLEGWVPVREGLFAEPERHRLRFLVAWNGAEGKFAVTCHDRTAQQRRLREGAR
LGPEPEPKPEAAVSPSSWAGLLSAAGLRGAHRQLAALWPPLERCFPRLPPELDVGGGGAW
GLGLGLWALLWPTRAGPGEAALQELCGQLERYLGAAADGCGGATVRDALFPAEGGAADCE
SPREFRERALRARWVEADARLRQVIQGHGKANTMVALMNVYQEEDEAYQELVTVATMFFQ
YLLQPFRAMREVATLCKLDILKSLDEDDLGPRRVVALEKEAEEWTRRAEEAVVSIQDITV
NYFKETVKALAGMQKEMEQDAKRFGQAAWATAIPRLEKLQLMLARETLQLMRAKELCLNH
KRAEIQGKMEDLPEQEKNTNVVDELEIQFYEIQLELYEVKFEILKNEEILLTTQLDSLKR
LIKEKQDEVVYYDPCENPEELKVIDCVVGLQDDKNLEVKELRRQCQQLESKRGRICAKRA
SLRSRKDQCKENHRFRLQQAEESIRYSRQHHSIQMKRDKIKEEEQKKKEWINQERQKTLQ
RLRSFKDKRLAQSVRNTSGSEPVAPNLPSDLSQQMCLPASHAVSVIHPSSRKTRGVPLSE
AGNVKSPKCQNCHGNIPVQVFVPVGDQTHSKSSEELSLPPPPPPPPPPPPPPPPPPPPLR
ALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDSLESFSCPGSMDEVLASLRHG
RAPLRKVEVPAVRPPHASINEHILAAIRQGVKLKKVHPDLGPNPSSKPTSNRRTSDLERS
IKAALQRIKRVSADSEEDSDEQDPGQWDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF30	1.000	1.000	0.000	809	1.000	1.000	Q8TF30.pdb.gz	WHAMM_HUMAN WASP homolog-associated protein with actin, membranes and microtubules OS=Homo sapiens OX=9606 GN=WHAMM PE=1 SV=2
2	AFDB:Q571B6	0.640	0.652	1.130E-73	793	0.663	0.676	Q571B6.pdb.gz	WHAMM_MOUSE WASP homolog-associated protein with actin, membranes and microtubules OS=Mus musculus OX=10090 GN=Whamm PE=1 SV=2
3	AFDB:Q9QXM1	0.546	0.458	2.336E-43	983	0.398	0.328	Q9QXM1.pdb.gz	JMY_MOUSE Junction-mediating and -regulatory protein OS=Mus musculus OX=10090 GN=Jmy PE=1 SV=1
4	AFDB:Q8N9B5	0.497	0.416	3.579E-42	988	0.392	0.321	Q8N9B5.pdb.gz	JMY_HUMAN Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY PE=1 SV=2
5	AFDB:B5X0I6	0.078	0.065	9.103E-5	1091	0.093	0.069	B5X0I6.pdb.gz	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
6	AFDB:Q62018	0.105	0.080	4.016E-4	1173	0.124	0.085	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
7	AFDB:Q8CIS0	0.119	0.088	9.973E-4	1159	0.130	0.091	Q8CIS0.pdb.gz	CAR11_MOUSE Caspase recruitment domain-containing protein 11 OS=Mus musculus OX=10090 GN=Card11 PE=1 SV=2
8	AFDB:A0A0R4IIN0	0.076	0.059	6.151E-3	1121	0.121	0.087	A0A0R4IIN0.pdb.gz	A0A0R4IIN0_DANRE Serine/threonine-protein kinase TAO2 isoform X4 OS=Danio rerio OX=7955 GN=taok2b PE=4 SV=2
9	AFDB:O74814	0.112	0.195	8.600E-3	387	0.068	0.142	O74814.pdb.gz	YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC337.03 PE=1 SV=1
10	AFDB:Q9SY69	0.053	0.051	1.041E-2	913	0.140	0.124	Q9SY69.pdb.gz	PPR29_ARATH Pentatricopeptide repeat-containing protein At1g10270 OS=Arabidopsis thaliana OX=3702 GN=GRP23 PE=1 SV=1
11	PDB:3msvA	0.097	0.185	4.155E-2	352	0.048	0.111	3msvA.pdb.gz
12	PDB:4k1nA	0.096	0.135	4.797E-2	520	0.066	0.102	4k1nA.pdb.gz
13	PDB:7tdzC	0.046	0.056	6.393E-2	653	0.093	0.115	7tdzC.pdb.gz	Structure of cytoplasmic ring of nuclear pore complex by integrative cryo-EM and AlphaFold.
14	PDB:6fyxo	0.059	0.081	1.032E-1	529	0.044	0.068	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
15	PDB:6q82A	0.089	0.075	1.136E-1	1027	0.041	0.032	6q82A.pdb.gz	Structural basis for the nuclear import and export functions of the biportin Pdr6/Kap122.
16	PDB:4f7rD	0.084	0.200	1.375E-1	238	0.040	0.134	4f7rD.pdb.gz
17	PDB:7ajlAAA	0.107	0.227	1.665E-1	290	0.038	0.107	7ajlAAA.pdb.gz
18	PDB:7po24	0.061	0.073	1.747E-1	592	0.084	0.115	7po24.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
19	PDB:7dkhI	0.061	0.055	1.833E-1	914	0.068	0.060	7dkhI.pdb.gz
20	PDB:5nrlJ	0.065	0.066	2.116E-1	800	0.068	0.069	5nrlJ.pdb.gz	Structure of a pre-catalytic spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q571B6	0.0	937	793	0.665	0.678	WHAMM_MOUSE WASP homolog-associated protein with actin, membranes and microtubules OS=Mus musculus OX=10090 GN=Whamm PE=1 SV=2
2	Q8TF30	0.0	1648	809	1.000	1.000	WHAMM_HUMAN WASP homolog-associated protein with actin, membranes and microtubules OS=Homo sapiens OX=9606 GN=WHAMM PE=1 SV=2
3	Q9QXM1	3.70e-123	396	983	0.339	0.279	JMY_MOUSE Junction-mediating and -regulatory protein OS=Mus musculus OX=10090 GN=Jmy PE=1 SV=1
4	Q8N9B5	8.00e-115	374	988	0.247	0.202	JMY_HUMAN Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY PE=1 SV=2
5	Q9CW79	1.86e-04	47.4	758	0.084	0.090	GOGA1_MOUSE Golgin subfamily A member 1 OS=Mus musculus OX=10090 GN=Golga1 PE=1 SV=2
6	A0A0S2Z4R4	0.070	39.3	777	0.053	0.055	A0A0S2Z4R4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=2 SV=1
7	O14964	0.070	39.3	777	0.053	0.055	HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1
8	A0A0S2Z4Q4	0.089	38.9	699	0.053	0.062	A0A0S2Z4Q4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1
9	Q99LI8	0.17	38.1	775	0.052	0.054	HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus OX=10090 GN=Hgs PE=1 SV=2
10	Q9Z0R6	0.18	38.1	1659	0.061	0.030	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
11	Q8IDX6	0.29	37.4	3130	0.047	0.012	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
12	Q9JJ50	0.39	36.6	776	0.052	0.054	HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus OX=10116 GN=Hgs PE=1 SV=1
13	Q960X8	1.7	34.7	760	0.072	0.076	HRS_DROME Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Drosophila melanogaster OX=7227 GN=Hrs PE=1 SV=1
14	F1MD77	5.5	33.1	1608	0.051	0.025	F1MD77_BOVIN Laminin subunit gamma 1 OS=Bos taurus OX=9913 GN=LAMC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15871 JMY	1.1e-162	553.0	Junction-mediating and -regulatory protein
2	PF02205 WH2	12	17.1	WH2 motif
3	PF15920 WHAMM-JMY_N	5.3e-25	98.4	N-terminal of Junction-mediating and WASP homolog-associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286760

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365891	0.947	Wiskott-Aldrich syndrome protein
2	9606.ENSP00000367220	0.909	Actin-related protein 2
3	9606.ENSP00000383118	0.893	Cell division control protein 42 homolog
4	9606.ENSP00000263238	0.885	Actin-related protein 3
5	9606.ENSP00000256001	0.831	Actin-related protein 3B
6	9606.ENSP00000458162	0.815	Actin, cytoplasmic 2
7	9606.ENSP00000349960	0.812	Actin, cytoplasmic 1
8	9606.ENSP00000252071	0.800	Actin-related protein 3C
9	9606.ENSP00000320176	0.800	Hematopoietic lineage cell-specific protein
10	9606.ENSP00000459943	0.718	Rabankyrin-5
11	9606.ENSP00000354669	0.711	Ubiquitin carboxyl-terminal hydrolase MINDY-1
12	9606.ENSP00000483313	0.711	Wiskott-Aldrich syndrome protein family member 2
13	9606.ENSP00000473565	0.705	DENN domain-containing protein 4C
14	9606.ENSP00000335055	0.703	Wiskott-Aldrich syndrome protein family member 3
15	9606.ENSP00000376368	0.691	Wiskott-Aldrich syndrome protein family member 1
16	9606.ENSP00000416097	0.656	Golgin subfamily A member 2
17	9606.ENSP00000388169	0.655	Actin-related protein 2/3 complex subunit 4
18	9606.ENSP00000477515	0.654	Diacylglycerol kinase kappa
19	9606.ENSP00000387982	0.639	WD repeat-containing protein 73
20	9606.ENSP00000308576	0.626	Rho-related GTP-binding protein RhoD

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0031267	1.000	small GTPase binding
GO:0008017	1.000	microtubule binding
GO:0071933	0.989	Arp2/3 complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071840	0.995	cellular component organization or biogenesis
GO:0050794	0.991	regulation of cellular process
GO:0030029	0.988	actin filament-based process
GO:0007010	0.988	cytoskeleton organization
GO:0030036	0.982	actin cytoskeleton organization
GO:1902903	0.967	regulation of supramolecular fiber organization
GO:0032956	0.966	regulation of actin cytoskeleton organization
GO:0006888	0.960	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0048522	0.957	positive regulation of cellular process
GO:0007015	0.952	actin filament organization
GO:0110053	0.946	regulation of actin filament organization
GO:0022607	0.916	cellular component assembly
GO:0051130	0.863	positive regulation of cellular component organization
GO:0120036	0.747	plasma membrane bounded cell projection organization
GO:0097581	0.743	lamellipodium organization
GO:0051495	0.457	positive regulation of cytoskeleton organization
GO:0007155	0.430	cell adhesion
GO:0034329	0.421	cell junction assembly
GO:1902905	0.370	positive regulation of supramolecular fiber organization
GO:0050896	0.361	response to stimulus
GO:0051125	0.357	regulation of actin nucleation
GO:0120031	0.311	plasma membrane bounded cell projection assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.999	cytosol
GO:0098588	0.999	bounding membrane of organelle
GO:0012505	0.998	endomembrane system
GO:0005794	0.993	Golgi apparatus
GO:0005793	0.990	endoplasmic reticulum-Golgi intermediate compartment
GO:0000139	0.969	Golgi membrane
GO:0033116	0.961	endoplasmic reticulum-Golgi intermediate compartment membrane
GO:0005634	0.870	nucleus
GO:0031982	0.865	vesicle
GO:0031974	0.668	membrane-enclosed lumen
GO:0070013	0.632	intracellular organelle lumen
GO:0043232	0.515	intracellular non-membrane-bounded organelle
GO:0031981	0.425	nuclear lumen
GO:0071944	0.389	cell periphery
GO:0005886	0.350	plasma membrane
GO:0097708	0.301	intracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]