StarFunc result for job id Q8TF32

User Input

>input (576 residues)
MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWECLNPAQQNLY
MNVMLENYKNLVFLGVAVSKQDPVTCLEQEKEPWNMKRHEMVDEPPAMCSYFTKDLWPEQ
DIKDSFQQVILRRYGKCEHENLQLRKGSASVDEYKVHKEGYNELNQCLTTTQSKIFPCDK
YVKVFHKFLNANRHKTRHTGKKPFKCKKCGKSFCMLLHLSQHKRIHIRENSYQCEECGKA
FKWFSTLTRHKRIHTGEKPFKCEECGKAFKQSSTLTTHKIIHTGEKPYRCEECGKAFNRS
SHLTTHKIIHTGEKPYKCEECGKAFNQSSTLSTHKFIHAGEKPYKCEECDKAFNRFSYLT
KHKIIHTGEKSYKCEECGKGFNWSSTLTKHKRIHTGEKPYKCEVCGKAFNESSNLTTHKM
IHTGEKPYKCEECGKAFNRSPQLTAHKIIHTGEKPYKCEECGKAFSQSSILTTHKRIHTG
EKPYKCEECGKAFNRSSNLTKHKIIHTGEKSYKCEECGKAFNQSSTLTKHRKIHTRQKPY
NCEECDNTFNQSSNLIKQNNSYWRETLQMSRMWESL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9H8G1	0.549	0.554	5.432E-73	570	0.783	0.791	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
2	AFDB:Q03923	0.482	0.469	2.588E-67	595	0.696	0.674	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
3	AFDB:A6NNF4	0.413	0.335	4.055E-67	738	0.684	0.534	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	AFDB:P35789	0.305	0.285	1.246E-66	620	0.663	0.616	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	AFDB:Q14593	0.479	0.485	1.317E-66	569	0.668	0.677	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
6	AFDB:Q03936	0.459	0.453	5.994E-66	586	0.696	0.684	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	AFDB:Q8IYN0	0.597	0.627	1.111E-65	542	0.714	0.758	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
8	AFDB:Q05481	0.452	0.235	2.300E-64	1191	0.677	0.327	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
9	AFDB:O75437	0.450	0.404	5.337E-64	659	0.668	0.584	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
10	AFDB:Q8TD23	0.483	0.489	1.383E-62	568	0.665	0.674	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
11	PDB:3w5kB	0.089	0.267	2.881E-4	110	0.068	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7kpxC	0.073	0.048	9.304E-1	1352	0.099	0.042	7kpxC.pdb.gz
13	PDB:5dkaA	0.057	0.230	1.041	96	0.031	0.188	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:8ap8d	0.072	0.120	1.164	270	0.062	0.133	8ap8d.pdb.gz
15	PDB:7pe9I	0.060	0.086	1.824	317	0.033	0.060	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
16	PDB:5khrN	0.073	0.068	1.930	645	0.054	0.048	5khrN.pdb.gz
17	PDB:5oqj2	0.067	0.083	2.041	395	0.045	0.066	5oqj2.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:7tveG	0.056	0.093	2.041	307	0.061	0.114	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
19	PDB:7o4iW	0.049	0.072	2.159	312	0.043	0.080	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
20	PDB:5gm6a	0.037	0.131	2.283	123	0.054	0.252	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	542	616	0.477	0.446	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	566	659	0.491	0.429	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	714	809	0.660	0.470	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	751	620	0.663	0.616	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	796	595	0.696	0.674	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	802	586	0.698	0.686	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	553	1191	0.484	0.234	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	764	569	0.668	0.677	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	633	474	0.557	0.677	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	901	569	0.783	0.793	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q49A12	682	536	0.602	0.647	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
12	Q5JVG8	592	444	0.505	0.655	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
13	Q6ZR52	595	646	0.547	0.488	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
14	Q8IW36	599	515	0.547	0.612	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
15	Q8IYB9	698	648	0.606	0.539	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
16	Q8IYN0	813	542	0.703	0.747	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
17	Q8IYX0	563	411	0.497	0.696	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
18	Q8TD23	749	568	0.660	0.669	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
19	Q96H40	602	463	0.531	0.661	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
20	Q96JC4	700	524	0.611	0.672	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	0.008	27.8	BolA-like protein
2	PF07975 C1_4	17	17.1	TFIIH C1-like domain
3	PF01352 KRAB	1.9e-19	80.3	KRAB box
4	PF16919 PknG_rubred	5.4e+02	12.1	Protein kinase G rubredoxin domain
5	PF01286 XPA_N	2.8e-14	64.1	XPA protein N-terminal
6	PF01428 zf-AN1	0.034	25.6	AN1-like Zinc finger
7	PF00096 zf-C2H2	3.7e-64	220.9	Zinc finger, C2H2 type
8	PF16622 zf-C2H2_11	5.5e-11	53.3	zinc-finger C2H2-type
9	PF13894 zf-C2H2_4	3.2e-33	122.5	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	2.8e-17	73.5	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	7.1e-16	69.3	Zinc-finger double-stranded RNA-binding
12	PF13465 zf-H2C2_2	1.9e-100	336.5	Zinc-finger double domain
13	PF02591 zf-RING_7	3.5	19.2	C4-type zinc ribbon domain
14	PF18439 zf_UBZ	3.7e-12	57.0	Ubiquitin-Binding Zinc Finger
15	PF07191 zinc-ribbons_6	8.6e+02	11.3	zinc-ribbons
16	PF17032 zinc_ribbon_15	0.043	25.9	zinc-ribbon family
17	PF09723 Zn-ribbon_8	3.1e-10	51.3	Zinc ribbon domain
18	PF17283 Zn_ribbon_SprT	35	15.8	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000444628	0.547	Beta-galactosidase-1-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.901	regulation of biological process
GO:0050794	0.854	regulation of cellular process
GO:0006355	0.766	regulation of DNA-templated transcription
GO:0009987	0.629	cellular process
GO:0032502	0.590	developmental process
GO:0048856	0.563	anatomical structure development
GO:0048523	0.562	negative regulation of cellular process
GO:0032501	0.528	multicellular organismal process
GO:0048857	0.328	neural nucleus development
GO:0007275	0.312	multicellular organism development
GO:0045892	0.310	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0005737	0.828	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]