StarFunc result for job id Q8TF40

User Input

>input (1166 residues)
MAPTLFQKLFSKRTGLGAPGRDARDPDCGFSWPLPEFDPSQIRLIVYQDCERRGRNVLFD
SSVKRRNEDISVSKLGSDAQVKVFGKCCQLKPGGDSSSSLDSSVTSSSDIKDQCLKYQGS
RCSSDANMLGEMMFGSVAMSYKGSTLKIHQIRSPPQLMLSKVFTARTGSSICGSLNTLQD
SLEFINQDNNTLKADNNTVINGLLGNIGLSQFCSPRRAFSEQGPLRLIRSASFFAVHSNP
MDMPGRELNEDRDSGIARSASLSSLLITPFPSPNSSLTRSCASSYQRRWRRSQTTSLENG
VFPRWSIEESFNLSDESCGPNPGIVRKKKIAIGVIFSLSKDEDENNKFNEFFFSHFPLFE
SHMNKLKSAIEQAMKMSRRSADASQRSLAYNRIVDALNEFRTTICNLYTMPRIGEPVWLT
MMSGTPEKNHLCYRFMKEFTFLMENASKNQFLPALITAVLTNHLAWVPTVMPNGQPPIKI
FLEKHSSQSVDMLAKTHPYNPLWAQLGDLYGAIGSPVRLARTVVVGKRQDMVQRLLYFLT
YFIRCSELQETHLLENGEDEAIVMPGTVITTTLEKGEIEESEYVLVTMHRNKSSLLFKES
EEIRTPNCNCKYCSHPLLGQNVENISQQEREDIQNSSKELLGISDECQMISPSDCQEENA
VDVKQYRDKLRTCFDAKLETVVCTGSVPVDKCALSESGLESTEETWQSEKLLDSDSHTGK
AMRSTGMVVEKKPPDKIVPASFSCEAAQTKVTFLIGDSMSPDSDTELRSQAVVDQITRHH
TKPLKEERGAIDQHQETKQTTKDQSGESDTQNMVSEEPCELPCWNHSDPESMSLFDEYFN
DDSIETRTIDDVPFKTSTDSKDHCCMLEFSKILCTKNNKQNNEFCKCIETVPQDSCKTCF
PQQDQRDTLSILVPHGDKESSDKKIAVGTEWDIPRNESSDSALGDSESEDTGHDMTRQVS
SYYGGEQEDWAEEDEIPFPGSKLIEVSAVQPNIANFGRSLLGGYCSSYVPDFVLQGIGSD
ERFRQCLMSDLSHAVQHPVLDEPIAEAVCIIADMDKWTVQVASSQRRVTDNKLGKEVLVS
SLVSNLLHSTLQLYKHNLSPNFCVMHLEDRLQELYFKSKMLSEYLRGQMRVHVKELGVVL
GIESSDLPLLAAVASTHSPYVAQILL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF40	1.000	1.000	0.000	1166	1.000	1.000	Q8TF40.pdb.gz	FNIP1_HUMAN Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3
2	AFDB:Q9P278	0.475	0.495	8.089E-85	1114	0.494	0.517	Q9P278.pdb.gz	FNIP2_HUMAN Folliculin-interacting protein 2 OS=Homo sapiens OX=9606 GN=FNIP2 PE=1 SV=2
3	PDB:6ulgN	0.360	0.832	7.995E-29	483	0.268	0.646	6ulgN.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
4	PDB:6nzdI	0.318	0.931	5.595E-23	388	0.247	0.742	6nzdI.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
5	AFDB:B4UN32	0.039	0.038	1.375E-3	1208	0.113	0.109	B4UN32.pdb.gz	AWP3B_CANGA Adhesin AWP3b OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP3b PE=1 SV=2
6	AFDB:Q24595	0.053	0.049	1.594E-3	1293	0.115	0.104	Q24595.pdb.gz	XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster OX=7227 GN=Xpc PE=1 SV=2
7	PDB:6lt0C	0.104	0.288	1.789E-3	385	0.034	0.104	6lt0C.pdb.gz
8	AFDB:D6XEJ8	0.062	0.048	2.484E-3	1736	0.117	0.079	D6XEJ8.pdb.gz	D6XEJ8_TRYB2 Flagellar Member 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.10 PE=4 SV=1
9	AFDB:Q9FMM3	0.036	0.030	4.716E-3	1714	0.112	0.076	Q9FMM3.pdb.gz	EXA1_ARATH Protein ESSENTIAL FOR POTEXVIRUS ACCUMULATION 1 OS=Arabidopsis thaliana OX=3702 GN=EXA1 PE=1 SV=1
10	PDB:7o2wA	0.096	0.240	6.445E-3	418	0.029	0.081	7o2wA.pdb.gz
11	PDB:7mgeC	0.092	0.259	1.285E-2	365	0.029	0.093	7mgeC.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
12	AFDB:O74808	0.049	0.047	1.617E-2	1238	0.130	0.123	O74808.pdb.gz	CLR1_SCHPO Cryptic loci regulator protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr1 PE=1 SV=1
13	AFDB:Q6S002	0.043	0.042	2.922E-2	1238	0.087	0.082	Q6S002.pdb.gz	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
14	PDB:6ulgL	0.080	0.183	3.121E-2	458	0.024	0.061	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
15	AFDB:Q3BBV0	0.056	0.055	3.739E-2	1214	0.101	0.097	Q3BBV0.pdb.gz	NBPF1_HUMAN Neuroblastoma breakpoint family member 1 OS=Homo sapiens OX=9606 GN=NBPF1 PE=1 SV=2
16	AFDB:Q9R0I7	0.045	0.039	3.928E-2	1386	0.102	0.086	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
17	PDB:8dhbJ	0.073	0.201	2.032E-1	361	0.022	0.072	8dhbJ.pdb.gz	Structural basis for FLCN RagC GAP activation in MiT-TFE substrate-selective mTORC1 regulation.
18	PDB:7m6jE	0.022	0.066	3.546	296	0.009	0.034	7m6jE.pdb.gz	An atomic model for the human septin hexamer by cryo-EM.
19	PDB:7vbaN	0.029	0.153	4.111	151	0.003	0.026	7vbaN.pdb.gz	Structure of the human RNA polymerase I elongation complex.
20	PDB:4mqwB	0.023	0.183	4.319	109	0.010	0.110	4mqwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FD7	0.0	2195	1165	0.913	0.914	FNIP1_MOUSE Folliculin-interacting protein 1 OS=Mus musculus OX=10090 GN=Fnip1 PE=1 SV=1
2	Q80TD3	0.0	620	1108	0.295	0.310	FNIP2_MOUSE Folliculin-interacting protein 2 OS=Mus musculus OX=10090 GN=Fnip2 PE=1 SV=2
3	Q8TF40	0.0	2428	1166	1.000	1.000	FNIP1_HUMAN Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3
4	Q9P278	0.0	641	1114	0.311	0.326	FNIP2_HUMAN Folliculin-interacting protein 2 OS=Homo sapiens OX=9606 GN=FNIP2 PE=1 SV=2
5	E9PCH4	5.15e-40	164	1651	0.063	0.045	E9PCH4_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 PE=4 SV=1
6	C8V3P5	0.54	36.6	459	0.030	0.076	C8V3P5_EMENI Ubiquinol-cytochrome c reductase complex core protein 2 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08273 PE=4 SV=1
7	Q9P6K4	0.65	36.6	842	0.015	0.021	YLF7_SCHPO Uncharacterized protein C30C2.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC30C2.07 PE=1 SV=1
8	Q5BEM5	1.2	35.8	952	0.012	0.015	Q5BEM5_EMENI Spindle pole body component OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01005 PE=3 SV=1
9	B3DGV1	1.9	35.0	758	0.018	0.028	B3DGV1_DANRE Signal transducer and activator of transcription OS=Danio rerio OX=7955 GN=sb:eu508 PE=1 SV=1
10	Q58DK5	2.2	34.7	329	0.021	0.076	HEM2_BOVIN Delta-aminolevulinic acid dehydratase OS=Bos taurus OX=9913 GN=ALAD PE=2 SV=1
11	Q9C9Q1	4.0	33.5	242	0.015	0.070	Q9C9Q1_ARATH Histone deacetylase complex subunit OS=Arabidopsis thaliana OX=3702 GN=AFR1 PE=2 SV=1
12	P16157	5.9	33.5	1881	0.022	0.014	ANK1_HUMAN Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3
13	P07248	9.3	33.1	1323	0.016	0.014	ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADR1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08837 DUF1810	1.1e+02	14.0	Protein of unknown function (DUF1810)
2	PF14638 FNIP_C	3.5e-69	243.8	Folliculin-interacting protein C-terminus
3	PF14637 FNIP_M	9.9e-79	276.1	Folliculin-interacting protein middle domain
4	PF14636 FNIP_N	2.5e-24	98.4	Folliculin-interacting protein N-terminus
5	PF01981 PTH2	3.9e+02	12.8	Peptidyl-tRNA hydrolase PTH2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000421985

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000285071	0.999	Folliculin
2	9606.ENSP00000362092	0.971	Ras-related GTP-binding protein C
3	9606.ENSP00000358423	0.962	Ras-related GTP-binding protein D
4	9606.ENSP00000369899	0.956	Ras-related GTP-binding protein A
5	9606.ENSP00000262850	0.955	Ras-related GTP-binding protein B
6	9606.ENSP00000343118	0.939	Ragulator complex protein LAMTOR4
7	9606.ENSP00000278671	0.937	Ragulator complex protein LAMTOR1
8	9606.ENSP00000256644	0.929	Ragulator complex protein LAMTOR5
9	9606.ENSP00000424183	0.929	Ragulator complex protein LAMTOR3
10	9606.ENSP00000357288	0.922	Ragulator complex protein LAMTOR2
11	9606.ENSP00000363162	0.916	V-type proton ATPase subunit G 1
12	9606.ENSP00000285393	0.915	V-type proton ATPase subunit d 2
13	9606.ENSP00000379203	0.911	V-type proton ATPase subunit C 1
14	9606.ENSP00000290949	0.908	V-type proton ATPase subunit d 1
15	9606.ENSP00000302194	0.907	V-type proton ATPase subunit G 2
16	9606.ENSP00000281087	0.906	V-type proton ATPase subunit G 3
17	9606.ENSP00000272238	0.903	V-type proton ATPase subunit C 2
18	9606.ENSP00000434729	0.903	V-type proton ATPase 21 kDa proteolipid subunit
19	9606.ENSP00000216442	0.902	V-type proton ATPase subunit D
20	9606.ENSP00000264433	0.902	Folliculin-interacting protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051087	1.000	chaperone binding
GO:0042030	1.000	ATPase inhibitor activity
GO:0019899	0.998	enzyme binding
GO:0140677	0.997	molecular function activator activity
GO:0030695	0.996	GTPase regulator activity
GO:0005085	0.993	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0007154	0.982	cell communication
GO:0051716	0.982	cellular response to stimulus
GO:0032006	0.978	regulation of TOR signaling
GO:0019222	0.975	regulation of metabolic process
GO:0060255	0.951	regulation of macromolecule metabolic process
GO:0048522	0.950	positive regulation of cellular process
GO:0023052	0.949	signaling
GO:0080090	0.947	regulation of primary metabolic process
GO:0007165	0.942	signal transduction
GO:0051246	0.940	regulation of protein metabolic process
GO:0048523	0.917	negative regulation of cellular process
GO:0048584	0.897	positive regulation of response to stimulus
GO:0031323	0.894	regulation of cellular metabolic process
GO:0031929	0.894	TOR signaling
GO:1902533	0.883	positive regulation of intracellular signal transduction
GO:0010605	0.878	negative regulation of macromolecule metabolic process
GO:0031399	0.866	regulation of protein modification process
GO:0051172	0.848	negative regulation of nitrogen compound metabolic process
GO:1903131	0.848	mononuclear cell differentiation
GO:0030183	0.843	B cell differentiation
GO:0032008	0.761	positive regulation of TOR signaling
GO:0009893	0.730	positive regulation of metabolic process
GO:0031324	0.649	negative regulation of cellular metabolic process
GO:0031325	0.629	positive regulation of cellular metabolic process
GO:0010604	0.627	positive regulation of macromolecule metabolic process
GO:0010468	0.626	regulation of gene expression
GO:0051173	0.523	positive regulation of nitrogen compound metabolic process
GO:0009889	0.521	regulation of biosynthetic process
GO:0019220	0.519	regulation of phosphate metabolic process
GO:0010556	0.472	regulation of macromolecule biosynthetic process
GO:0051128	0.410	regulation of cellular component organization
GO:0019219	0.395	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.388	regulation of cellular biosynthetic process
GO:0042325	0.384	regulation of phosphorylation
GO:0051247	0.358	positive regulation of protein metabolic process
GO:0001932	0.327	regulation of protein phosphorylation
GO:0031401	0.321	positive regulation of protein modification process
GO:0051252	0.317	regulation of RNA metabolic process
GO:0042327	0.313	positive regulation of phosphorylation
GO:0031669	0.306	cellular response to nutrient levels
GO:0001934	0.304	positive regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.989	membrane
GO:0005829	0.989	cytosol
GO:0043231	0.985	intracellular membrane-bounded organelle
GO:0005764	0.968	lysosome
GO:0005774	0.967	vacuolar membrane
GO:0005765	0.956	lysosomal membrane
GO:0032991	0.554	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]