StarFunc result for job id Q8TF42

User Input

>input (649 residues)
MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALAS
TGGRSVQAACDWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKA
HNIFPHITLCQFFMCEDSKVDALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKED
SAEVLKKFAADFAAEAASKTEVHVEPHKKQLHVTLAYHFQASHLPTLEKLAQNIDVKLGC
DWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDFIFMSPMEQTSTSEGWIYGTS
LTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERRPYEDQGLGET
TPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN
MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHN
ILKGLQQENHLKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKL
VVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQ
MVRKIPYLGFCSCEELGETGIWQLTDPPILPLTHGPTGGFNWRETLLQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TF42	1.000	1.000	0.000	649	1.000	1.000	Q8TF42.pdb.gz	UBS3B_HUMAN Ubiquitin-associated and SH3 domain-containing protein B OS=Homo sapiens OX=9606 GN=UBASH3B PE=1 SV=2
2	AFDB:P57075	0.690	0.679	1.281E-73	661	0.441	0.433	P57075.pdb.gz	UBS3A_HUMAN Ubiquitin-associated and SH3 domain-containing protein A OS=Homo sapiens OX=9606 GN=UBASH3A PE=1 SV=1
3	AFDB:Q3V3E1	0.449	0.467	1.661E-73	624	0.445	0.463	Q3V3E1.pdb.gz	UBS3A_MOUSE Ubiquitin-associated and SH3 domain-containing protein A OS=Mus musculus OX=10090 GN=Ubash3a PE=1 SV=1
4	AFDB:Q9VCE9	0.447	0.388	4.114E-65	751	0.393	0.340	Q9VCE9.pdb.gz	EPP_DROME Ecdysteroid-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Epp PE=1 SV=1
5	AFDB:Q22323	0.395	0.894	2.020E-25	283	0.154	0.353	Q22323.pdb.gz	STPP_CAEEL Steroid-phosphate phosphatase OS=Caenorhabditis elegans OX=6239 GN=T07F12.1 PE=1 SV=2
6	AFDB:Q7YTB0	0.376	0.720	4.342E-21	331	0.143	0.281	Q7YTB0.pdb.gz	EPP_BOMMO Ecdysteroid-phosphate phosphatase OS=Bombyx mori OX=7091 GN=EPP PE=1 SV=2
7	PDB:2yn2A	0.266	0.625	9.116E-9	254	0.071	0.181	2yn2A.pdb.gz
8	AFDB:P53929	0.269	0.601	1.177E-8	270	0.071	0.170	P53929.pdb.gz	YNK8_YEAST Uncharacterized protein YNL108C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL108C PE=1 SV=1
9	AFDB:Q9UT63	0.248	0.656	3.504E-8	216	0.059	0.176	Q9UT63.pdb.gz	YKJ2_SCHPO Probable phosphatase SPAC513.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC513.02 PE=3 SV=1
10	AFDB:Q09676	0.248	0.625	4.313E-8	219	0.066	0.196	Q09676.pdb.gz	YA03_SCHPO Probable phosphatase SPAC5H10.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC5H10.03 PE=3 SV=1
11	AFDB:O50416	0.214	0.525	4.543E-8	236	0.063	0.174	O50416.pdb.gz	O50416_MYCTU Probable conserved lipoprotein LpqD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqD PE=1 SV=1
12	PDB:2h4zA	0.236	0.556	9.445E-8	255	0.079	0.200	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
13	PDB:6s2rA	0.228	0.571	1.431E-7	234	0.068	0.188	6s2rA.pdb.gz
14	PDB:1e58A	0.240	0.585	1.508E-7	247	0.074	0.194	1e58A.pdb.gz
15	PDB:6yj6C	0.267	0.502	2.059E-7	330	0.076	0.148	6yj6C.pdb.gz
16	PDB:1yjxA	0.233	0.564	2.407E-7	245	0.083	0.220	1yjxA.pdb.gz	Crystal structure of human B-type phosphoglycerate mutase bound with citrate.
17	PDB:1riiA	0.229	0.571	5.246E-7	243	0.076	0.202	1riiA.pdb.gz
18	PDB:1qhfA	0.233	0.577	6.803E-7	240	0.077	0.208	1qhfA.pdb.gz	Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A.
19	PDB:4embA	0.236	0.574	8.374E-7	245	0.071	0.188	4embA.pdb.gz
20	PDB:3lg2A	0.231	0.524	1.086E-6	269	0.080	0.193	3lg2A.pdb.gz	Structure and activity of the metal-independent fructose-1,6-bisphosphatase YK23 from Saccharomyces cerevisiae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5YC04	0.0	1222	600	0.894	0.967	A0A8I5YC04_RAT Ubiquitin associated and SH3 domain containing, B OS=Rattus norvegicus OX=10116 GN=Ubash3b PE=4 SV=1
2	F1LV21	0.0	1184	614	0.867	0.917	F1LV21_RAT Ubiquitin associated and SH3 domain containing, B OS=Rattus norvegicus OX=10116 GN=Ubash3b PE=4 SV=3
3	P57075	0.0	560	661	0.453	0.445	UBS3A_HUMAN Ubiquitin-associated and SH3 domain-containing protein A OS=Homo sapiens OX=9606 GN=UBASH3A PE=1 SV=1
4	Q3V3E1	0.0	564	624	0.453	0.471	UBS3A_MOUSE Ubiquitin-associated and SH3 domain-containing protein A OS=Mus musculus OX=10090 GN=Ubash3a PE=1 SV=1
5	Q8BGG7	0.0	1311	638	0.960	0.976	UBS3B_MOUSE Ubiquitin-associated and SH3 domain-containing protein B OS=Mus musculus OX=10090 GN=Ubash3b PE=1 SV=1
6	Q8TF42	0.0	1357	649	1.000	1.000	UBS3B_HUMAN Ubiquitin-associated and SH3 domain-containing protein B OS=Homo sapiens OX=9606 GN=UBASH3B PE=1 SV=2
7	Q9VCE9	6.84e-73	251	751	0.214	0.185	EPP_DROME Ecdysteroid-phosphate phosphatase OS=Drosophila melanogaster OX=7227 GN=Epp PE=1 SV=1
8	Q22323	2.21e-56	194	283	0.157	0.360	STPP_CAEEL Steroid-phosphate phosphatase OS=Caenorhabditis elegans OX=6239 GN=T07F12.1 PE=1 SV=2
9	Q7YTB0	3.45e-46	168	331	0.153	0.299	EPP_BOMMO Ecdysteroid-phosphate phosphatase OS=Bombyx mori OX=7091 GN=EPP PE=1 SV=2
10	Q499N6	2.84e-11	67.0	297	0.048	0.104	UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ubxn1 PE=3 SV=2
11	E9PJ81	3.88e-11	66.6	290	0.048	0.107	E9PJ81_HUMAN UBX domain protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=1
12	E9PRQ7	4.15e-11	66.6	293	0.048	0.106	E9PRQ7_HUMAN UBX domain protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=1
13	Q04323	4.61e-11	66.6	297	0.048	0.104	UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2
14	Q8IGB7	2.21e-07	55.8	350	0.040	0.074	Q8IGB7_DROME RH64582p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
15	Q966U7	2.34e-07	55.5	313	0.040	0.083	Q966U7_DROME CAP, isoform E OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
16	A1Z871	2.67e-07	56.6	1734	0.040	0.015	A1Z871_DROME CAP, isoform B OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
17	Q966V0	2.79e-07	56.6	1743	0.040	0.015	Q966V0_DROME CAP, isoform R OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
18	A0A0B4KEJ6	3.15e-07	56.2	1586	0.040	0.016	A0A0B4KEJ6_DROME CAP, isoform W OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
19	A0A0B4KEH7	3.52e-07	56.2	2409	0.040	0.011	A0A0B4KEH7_DROME CAP, isoform Y OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
20	B7YZD9	3.52e-07	56.2	2365	0.040	0.011	B7YZD9_DROME CAP, isoform L OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13563 2_5_RNA_ligase2	0.18	23.3	2'-5' RNA ligase superfamily
2	PF00782 DSPc	2e+02	13.2	Dual specificity phosphatase, catalytic domain
3	PF00300 His_Phos_1	1.1e-13	62.8	Histidine phosphatase superfamily (branch 1)
4	PF02834 LigT_PEase	0.92	21.1	LigT like Phosphoesterase
5	PF00018 SH3_1	0.037	24.9	SH3 domain
6	PF14604 SH3_9	4.8e-12	57.0	Variant SH3 domain
7	PF00627 UBA	0.0015	29.7	UBA/TS-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284273

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.931	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000275493	0.926	Epidermal growth factor receptor
3	9606.ENSP00000364907	0.851	Tyrosine-protein kinase SYK
4	9606.ENSP00000401303	0.821	SHC-transforming protein 1
5	9606.ENSP00000046794	0.808	Lymphocyte cytosolic protein 2
6	9606.ENSP00000412189	0.805	Phosphoglycerate mutase family member 4
7	9606.ENSP00000359991	0.804	Phosphoglycerate mutase 1
8	9606.ENSP00000298229	0.761	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
9	9606.ENSP00000441543	0.748	Polyubiquitin-C
10	9606.ENSP00000378356	0.745	Kinesin-like protein KIF20A
11	9606.ENSP00000264972	0.728	Tyrosine-protein kinase ZAP-70
12	9606.ENSP00000354972	0.726	N-alpha-acetyltransferase 35, NatC auxiliary subunit
13	9606.ENSP00000442600	0.726	Dystroglycan
14	9606.ENSP00000340017	0.680	Double C2-like domain-containing protein alpha
15	9606.ENSP00000262138	0.675	Voltage-dependent calcium channel gamma-4 subunit
16	9606.ENSP00000376345	0.670	Growth factor receptor-bound protein 2
17	9606.ENSP00000362759	0.669	Adhesion G protein-coupled receptor B2
18	9606.ENSP00000368237	0.651	Atlastin-2
19	9606.ENSP00000313950	0.616	Aurora kinase B
20	9606.ENSP00000434727	0.614	Coiled-coil domain containing 180

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.871	catalytic activity
GO:0042802	0.831	identical protein binding
GO:0019899	0.479	enzyme binding
GO:0140096	0.411	catalytic activity, acting on a protein
GO:0016791	0.400	phosphatase activity
GO:0004725	0.320	protein tyrosine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.990	biological regulation
GO:0050794	0.977	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0048523	0.971	negative regulation of cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0048583	0.958	regulation of response to stimulus
GO:0002682	0.925	regulation of immune system process
GO:0023051	0.905	regulation of signaling
GO:0008152	0.904	metabolic process
GO:0010646	0.897	regulation of cell communication
GO:0044238	0.871	primary metabolic process
GO:0071704	0.850	organic substance metabolic process
GO:0051239	0.794	regulation of multicellular organismal process
GO:0009966	0.777	regulation of signal transduction
GO:0044237	0.772	cellular metabolic process
GO:0048585	0.735	negative regulation of response to stimulus
GO:0006807	0.681	nitrogen compound metabolic process
GO:0006796	0.643	phosphate-containing compound metabolic process
GO:0060255	0.636	regulation of macromolecule metabolic process
GO:0050896	0.562	response to stimulus
GO:0023052	0.552	signaling
GO:1901564	0.532	organonitrogen compound metabolic process
GO:0019538	0.517	protein metabolic process
GO:0007154	0.492	cell communication
GO:0051716	0.482	cellular response to stimulus
GO:0045936	0.482	negative regulation of phosphate metabolic process
GO:0042326	0.448	negative regulation of phosphorylation
GO:0051171	0.415	regulation of nitrogen compound metabolic process
GO:0080090	0.413	regulation of primary metabolic process
GO:0009968	0.413	negative regulation of signal transduction
GO:0007165	0.384	signal transduction
GO:0036211	0.369	protein modification process
GO:0001933	0.347	negative regulation of protein phosphorylation
GO:0007166	0.346	cell surface receptor signaling pathway
GO:0032501	0.344	multicellular organismal process
GO:0065008	0.343	regulation of biological quality
GO:0048518	0.330	positive regulation of biological process
GO:0051338	0.324	regulation of transferase activity
GO:0043086	0.317	negative regulation of catalytic activity
GO:0035335	0.317	peptidyl-tyrosine dephosphorylation
GO:0033673	0.300	negative regulation of kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0005654	0.993	nucleoplasm
GO:0005576	0.975	extracellular region
GO:0005615	0.937	extracellular space
GO:0065010	0.915	extracellular membrane-bounded organelle
GO:1903561	0.913	extracellular vesicle
GO:0070062	0.893	extracellular exosome
GO:0016020	0.846	membrane
GO:0005794	0.607	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.400	Phosphoric monoester hydrolases.
RHEA:10684	0.320	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.320	protein-tyrosine-phosphatase.

[back to server]